SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001095 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001095
Domain Number 1 Region: 144-450
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-98
Family Protein kinases, catalytic subunit 0.0000000000981
Further Details:      
 
Domain Number 2 Region: 8-126
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-17
Family Pleckstrin-homology domain (PH domain) 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001095   Gene: ENSONIG00000000863   Transcript: ENSONIT00000001094
Sequence length 479
Comment pep:known_by_projection scaffold:Orenil1.0:GL831135.1:4191459:4213701:1 gene:ENSONIG00000000863 transcript:ENSONIT00000001094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQSVYVCVTSFGQMRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDSPDERDEWTEAIQMVADKLQRQEEERIQCS
PTSNIDNMVEEEMDISTTHHKRKTMSDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEERTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSADAKSLLSGLLFKDPNKRLGGGPDDAKEIMRHSFFSGIDWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKFDEDGMDCLDNERRPHFPQFSYSASGRE
Download sequence
Identical sequences I3IWV5
ENSONIP00000001095 ENSONIP00000001095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]