SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001100 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001100
Domain Number 1 Region: 903-1097
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.75e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000596
Further Details:      
 
Domain Number 2 Region: 698-818
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-27
Family Pleckstrin-homology domain (PH domain) 0.0000417
Further Details:      
 
Domain Number 3 Region: 36-156
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-19
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001100   Gene: ENSONIG00000000868   Transcript: ENSONIT00000001099
Sequence length 1420
Comment pep:known_by_projection scaffold:Orenil1.0:GL831149.1:1283848:1309184:-1 gene:ENSONIG00000000868 transcript:ENSONIT00000001099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNHISLCLQAKGRRDGFSSAGDNPRPPMATRPGREGVGMGWKGPRTLVLHKNSQGFGFTL
RHFIVYPPESALHTNLKDEENGNGKGFQKGQLEPMDTIFVKNVREKGPAHQAGLCTGDRL
VKVNGESILGKTYSQVIALIQNSESVLELSIMPKDEDVLQLAYSQDAYLTGNEPYAGGAE
NLPPPPPLCYPRSKTTSVSGAPLSSPMGQNQLDNWSRWPGSSSPSSPLDNRSAVCSPASW
QEGRPGEPGGVGHSSPAHRTEEIQYGMTSQQPQGQAQPRKSSSAWTSPPQPQVSHSRSDR
CQQALSDWYHNQQPDRSVRKMQTRHRSYSQDRLSESRRQQQRTGGWPHSASQDTLLLLQQ
SGYTRTRSENLLALYDHHGRSLEMLDRGAAGLVSPRIDRPAWLSQPTSKHHPQTHTQPQP
APTQSRRLPPGQSVDDQPVGYRSYSPSFYRKTGRILQQAHSFRDPSYSGPHLNWNPVPKT
SPPEGTPAPPTASTTTPVASATPESQDRGQEVVMRQKPPTGRRNVQDPKDSAPAPGSTGD
VASGKPNGNLAPLPLEDDSLASIPFIDEPTSPSADLRARHVPASSVVSSGMSSTPAVVNS
PASPTFTFPLTRLFSHDCSSIKSSRRSSYVLAISSERSKSCDEGLNTFREDGRSFRRLPK
RVKSFFTDGSLDNIGTAEEVRSKRHSTSELGNITYSDVRREGWLHYKQIHTEKGKKVGSA
MRPWKRVFSVLRSQSLFLYKDKREAVLRGATIGGSAEDEQPISIQGCLVDIAYSETKRKH
ALRLTTQDFCEYLLQAEDREDMLNWIKVIGENSKIDNEEFGFSRQALINKKLNDYRKQSP
AVNKPDSSPKLSRMKPPFLLNKTENAAGAPRSPKPEGKDESSPPKSPWGINIMKKTKKAG
PKAFGVRLEECQPGTNNKFVPMIVEICCGLVEEMGLEYTGIYRVPGNNAMVSLLQEQLNK
GVDINPAEEKWQDLNVVSSLLKSFFRKLPEPLFTNDKYNDFIDANRMENASDRLKTMKKL
IRDLPDHYYHTLKFLVGHLKTVADSSDKNKMEPRNLALVFGPTLVRTSEDNMKDMVTHMP
DRYKIVETLIQHCTWFFTDELDKDEKTPVDTEDVQPAPNIDHLLSNIGRTALLGEASDST
NSDSAKSKGSWGSKKDLTAKEFLALSIMSAVTGRKRRKRHNARRVGSSTDDDSEHEPIKA
GHLGAGEEEEVESPIGDTAPRAEGEEDDDEEPQWRAPEDARSIVSGYSTLSTLGRSLGSE
GRGDDADDEHSELVSETDNESGFASRSLTQRLHSRPSFNSHKLIQCDTLARRKLNEGTAP
SEGSGSGTEGAPTAKRDTSRTNTSSGSSQESLRLARPKPAVLPSEAASFTPTGLGGKSLA
NQVRARLLGSADNLHRVGLRKPPSPETRRKKRAWRRHTVV
Download sequence
Identical sequences I3IWW0
ENSONIP00000001100 ENSONIP00000001100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]