SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001183 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001183
Domain Number 1 Region: 329-461
Classification Level Classification E-value
Superfamily C-type lectin-like 2.49e-37
Family C-type lectin domain 0.00015
Further Details:      
 
Domain Number 2 Region: 186-319
Classification Level Classification E-value
Superfamily C-type lectin-like 1.62e-35
Family C-type lectin domain 0.0005
Further Details:      
 
Domain Number 3 Region: 471-608
Classification Level Classification E-value
Superfamily C-type lectin-like 4.39e-34
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 4 Region: 771-902
Classification Level Classification E-value
Superfamily C-type lectin-like 7.3e-33
Family C-type lectin domain 0.00064
Further Details:      
 
Domain Number 5 Region: 915-1061
Classification Level Classification E-value
Superfamily C-type lectin-like 2.16e-31
Family C-type lectin domain 0.00087
Further Details:      
 
Domain Number 6 Region: 614-753
Classification Level Classification E-value
Superfamily C-type lectin-like 5.95e-31
Family C-type lectin domain 0.00029
Further Details:      
 
Domain Number 7 Region: 1083-1200
Classification Level Classification E-value
Superfamily C-type lectin-like 2.58e-27
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 8 Region: 1216-1343
Classification Level Classification E-value
Superfamily C-type lectin-like 1.36e-22
Family C-type lectin domain 0.0033
Further Details:      
 
Domain Number 9 Region: 124-181
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-20
Family Fibronectin type II module 0.00062
Further Details:      
 
Domain Number 10 Region: 2-122
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000000117
Family Cysteine rich domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001183   Gene: ENSONIG00000000936   Transcript: ENSONIT00000001182
Sequence length 1429
Comment pep:known_by_projection scaffold:Orenil1.0:GL831149.1:1786295:1804020:-1 gene:ENSONIG00000000936 transcript:ENSONIT00000001182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAFYLEGEGKCLGVQDRSLALSAACEEPNQRWKWVTRRRLFNLGSSLCLGVITNNGSFRL
DKFPLGVYTCDREPPKVRWSWNCDQVLHNFNSYFPSDLPWNLTVVRSNWTLHGGLQDLCS
KTNQEIYTIQGNSNGRPCYLPFLYDGQWFHTCTSTGREDGHLWCATTYDYGKDELWGFCP
VKSNGCETFWDTDPVTDSCYQFNFQATLSWSEARISCQQQGADLLSITKLHEQTYINGLL
TGYSAALWIGLNDLDISGGWQWADSSPLKYLNWEQEQPNHAEEKNCAVIRTESSGRWQNR
DCSVALPYVCKKRPNATLDPFTTDSWADDEKYECDVGWQAFQAGCYKLTSEKTDWNTAQK
TCQKMEANLVSIHTLPELEFIIRDLNYESNTEQLWIGLHDTDMQMDFQWTDHTPVIFTYW
HPFEPNNFRNTQEDCVSVWGPEGRWDDSPCNLTLPSICKKTGTKSDGKPEHQQCKKGWKW
HSPACYWVGEEMLTFDGARKFCEDQGATLITITNRFEQAFASSLVSGHSGDSFWIGLRNK
GNHGAFQWITNEEVSYTHWNRDQPANISSGCVSMATDKEQGLWDVRECASSKAKFICRQG
PELPVPQPTPSLSGSCPSGWKSNSKLRYCYKVFHFSQLEQKLTWMRAHNFCRKHGANLLS
ISSSEEEQFVLQILHEAFGESEEHEQHWFWIGLNRRNPMDNGSWKWSDGLALTYQNFGRY
YYNIRQCAAADLGSMTWLAMHCDSELDWICKIPRGSVEKVPEITEVSWLHSGTSSPEWIG
FREAEYKFFDHRSTWDQAQRICSWFDSSLASVHSAEEQTFLANTLRKMSKVEGDLWWLGL
HTYENDGRFRWSDHSVLNYVAWALGRPLPISRDRKCICMSANKEDWADQKCHSDLPYICK
RVNVTGTAPPTPPSPHPPSGCRDGWSSFQHKCFRVFDQSNRVTWSAAKLNCESQGGVLAV
ISNHLQQAFVTTLLKNASTELWVGLTSDSKANFNWAKAGLLSYTNWAPGEPLDNSGPHQN
KTPGNCVVMYHENWQKKTGMWASRACEMESHGFICQRQQDQGLPPSPALIPASLSKPVEL
GGVTYRVVKKRLDWTGALHLCESLNGTLARVKDPFQQGYLTLLINSLRQPAWIGLYNYGV
QGRSFTWLNNEDVIYSNWNDGEPSLMAGCGHMTTTGQWTVTPCDSRLDAAICQMSDEPVI
HQWIYTGMCPQSLGEWAWVPFRNHCYAFNLQLLRLQDDAHRSCKKIGAELLSIMDETENG
FVWEHIQSYAEQAHGAWLGVNVKGRGLVWAEGTEMLYTNWEGHDVASSVLSINSCFWIQS
NTGRWKPGSCRNRTHGVICKRPRSKHKFPSLLLNLYPVDSHRLPTLIVVMVAGLVLVVLI
VGVIYFYRQRTVGSRGSYEGARYSRTNSNSAEQAEKNILVSDMELNEQP
Download sequence
Identical sequences I3IX43
ENSONIP00000001183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]