SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001261 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001261
Domain Number 1 Region: 489-716
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-54
Family Kelch motif 0.00027
Further Details:      
 
Domain Number 2 Region: 215-340
Classification Level Classification E-value
Superfamily POZ domain 7.85e-28
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001261   Gene: ENSONIG00000000996   Transcript: ENSONIT00000001260
Sequence length 723
Comment pep:known_by_projection scaffold:Orenil1.0:GL831143.1:4474750:4597927:1 gene:ENSONIG00000000996 transcript:ENSONIT00000001260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSPGDSQAPGLLLAPGVRWGQTPINQLTPWDTDEPPAKQHRDAEPTAPTWPAPVAAVSQ
PSLLSHTYALPQPPSFNHSVTAQSPIIGVTPSIQTPVPPQHPLMTAHFQLTPQSTQQPPS
MVLSMPSQPPYASAQPTVTPSALTAQANPVVHPNAHSMIGNGHLTSHPSLIQPHTLPLTN
GQAAAAAAHGQQTAADNQDGPNGLQMLRTVGSGKYEFSDPGHPKEMLKELNQQRRAKEFT
DLKIIVEGKEFEVHQNVLASCSLYFKDLVKRSSGETRSREMLELNMSNISADVLELLLEF
VYTGSLVIDSANAKTLLEAANKFQFNTFCKVCVSFLEKQLTAANCLGVLAMAEAMSCTEL
HNMAKAFALQNFPEVAGQEEILSVSKDDLIAYLSNDSLNTKAEELVYETVIKWIKQDPNS
RVQHLSELLAVVRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAKRYHMLPHARQEMQT
PRTRPRLSAGGTESGVMVADVWCYMSLLDNWNLVSRMTVARCRHNSLVYDGKLYTIGGLG
VSGNLDHVERYDTITNQWETVSPLPKPVHSAAATVCGGKIYVFGGVNEAGRSAGVLQSYV
PQSNTWSFIESPMIDNKYAPAVSLNGFIFILGGAYARATTIYDPDKGNIKAGPNMNHSRQ
FCSAVILDGKIYATGGIVSSEGPALGNMETFDPCTNTWTLLQSLPCPLFRHGCVVIKKYI
QSG
Download sequence
Identical sequences I3IXC1
ENSONIP00000001261 ENSONIP00000001261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]