SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001349 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001349
Domain Number 1 Region: 367-550
Classification Level Classification E-value
Superfamily Kelch motif 6.54e-28
Family Kelch motif 0.0019
Further Details:      
 
Domain Number 2 Region: 72-205
Classification Level Classification E-value
Superfamily POZ domain 2.47e-25
Family BTB/POZ domain 0.0044
Further Details:      
 
Domain Number 3 Region: 600-667
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000248
Family Kelch motif 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001349   Gene: ENSONIG00000001064   Transcript: ENSONIT00000001348
Sequence length 716
Comment pep:known_by_projection scaffold:Orenil1.0:GL831149.1:2105563:2108276:-1 gene:ENSONIG00000001064 transcript:ENSONIT00000001348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRQVGMAAGTPFTQCASSLLHFPPLLTSSAGSRMAAAAPNPEDSTRSSGSSGTSTPSAL
AGDGDAEEAEEFTSSSHCSELSRRQNEQRKQGLFCDVTLAFSSGAATGSVQSCEFSAHRS
VLAAATDYFTPLLGGQFSESLSGRVEMKEWSSELGPDPETVESVIQYMYTGEIRVSTCNV
HEVLELADRFLLLQLKDFCGEFLKKKLSLTNCVAVHSLAHMYTLDQLALRAADMIRRNFH
KVIQDEEFYTLPFHLVRDWLSDAEITVDSEEVLFEAVVKWVQKNPEERSRYFEELFRLLR
LPQIKPTYLTRVVKNERLVASNEACLRLVSEAVEGHAIRFENLKSADMEFWSSHMASFQP
RFGQNMDVIMVVGGVSEGGDYLSECVGYFIYEDRWVNLPHIHNHLDGHAIAATESHVYVA
GSMEPGFAKTVERYNPNRNTWEQVSNLTTRKHSFGLTCIKDILYSIGGHGNFSPGFKDVS
VYEPDQDKWHNLESAPKILRDVKAVSVEDRYVYVTARTPVDTDNEDGLKTVTTRYDTESR
QWQDVDSLPLIDNYCIFQMAVASTNFYHTASCCPKSYTVRDEVARQKISVRISDEILESL
PPEVTSIEGAAICHFDEDVFIIGGWKNSDDVDKQYRKEAYRYCAERKRWMLLPPMPQPRC
RATACHVRIPYRFLYGCQRYPMPQNLARQRDRMQQMQQLHRRTLTLRRQLQSQIEC
Download sequence
Identical sequences I3IXK9
ENSONIP00000001349 ENSONIP00000001349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]