SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001833 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001833
Domain Number 1 Region: 343-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-52
Family SPRY domain 0.00034
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-21
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000198
Family B-box zinc-binding domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001833   Gene: ENSONIG00000001459   Transcript: ENSONIT00000001832
Sequence length 522
Comment pep:novel scaffold:Orenil1.0:GL831491.1:59152:60829:-1 gene:ENSONIG00000001459 transcript:ENSONIT00000001832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQNGVQLDRETFSCSICLDLLKDPVTIPCGHSYCMNCIKTHWNTENTKKIYSCPQCRQT
FTPRPVLVKNTMLAVLVEQLKKTGLQAAPADHCYAGPEDVACDVCTGRKLKAFNSCLVCL
ASYCENHLQPHYDSPTFRKHKLVEPSKKLQENICSRHDEVTKMFCRTDQQIICHHCLIDE
HKGHNTVSAAAERTERQRELEVSRQNIQQRIQDREKDVKLLQQEVXRSQQETEVSRVKEL
EEKLEQEITELKRKGAELKQLSHTEDHIQFLHNYPSLSALSESTDSSSINIRPLRYFENV
TAVVSEVRDKLQDILREEWTNISLTVTEVDVLLSDPHTEPKTREGFLKYSREITLDPNTA
HKQLLLSEENRKIIAMNQQQSHSNHPDRFTEWFQVLSRESLTGRCYWEVERKGIGVYLAV
TYKNIKRSGNECAFGRNDKSWALECDTKSYTFWYNNYKTPVPGLPSSRVGVYLDHRAGIL
SFYSVSETMTLLHRVQTTFTQPLYAGLWLYSDYGNKAEFINL
Download sequence
Identical sequences I3IYZ3
ENSONIP00000001833 ENSONIP00000001833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]