SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002043 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002043
Domain Number 1 Region: 682-877
Classification Level Classification E-value
Superfamily Sec7 domain 3.66e-73
Family Sec7 domain 0.00000257
Further Details:      
 
Domain Number 2 Region: 83-155,443-626,1136-1538,1666-1807
Classification Level Classification E-value
Superfamily ARM repeat 1.68e-27
Family Armadillo repeat 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002043   Gene: ENSONIG00000001628   Transcript: ENSONIT00000002042
Sequence length 1833
Comment pep:known_by_projection scaffold:Orenil1.0:GL831362.1:663208:687177:1 gene:ENSONIG00000001628 transcript:ENSONIT00000002042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAENSKTKSMFLSRALEKILSDKEVKRSQHSQLRKACQVALDEIKEELEKQKFSGKACRD
GTVVPPRANYIEADKYVLPFELACQSKSPRIVSTSLDCLQKLIAYGHITGNAPDSRTPGK
RLIDRLVETICNCFQGPQTDEGVQLQIIKALLTTVTSPHIEIHEGTVLLTVRTCYNIYLA
SRNLINQTTAKATLTQMLNVIFTRMENQAALEAQEQEKERLRLPQQNPSPVPSSRRSGSP
RSDHTSTPEPQNSPSPAASTPDLTTNTSSSTHPSPAPDLDQDQEPDTPSVNGEVESENTP
PNGEAEQVTPSTGLCCQTAQQGDEGDKPESNSNPAENLLSCRCNDLKTSVLASSPGGEHP
PHPATEQTEVAPPRVRTEGQQMNGIIEDRSSLSSTDMLDAEALQGPHNAARFSHILQKDA
FLVFRSLCKLSMKPLADGPPDPKSHELRSKIVSLQLLLSVLQGAGPVFRTHEMFVNAIKQ
YLCVALSKNGVSSVPEVFELSLAIFLTLLSHFKVHLKMQIEVFFREIFLTILETSTSSFE
HKWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRSGQELGMTPL
QELSLRKKGLECLVSILKCMVEWSKDMYVNPNLQANLGQEHPSDSEGAELKLPEQLAGRR
DSISSLDSAISSSVAASQADHPEQYEVIKQQKDIIEHGIELFNKKPKRGIQYLQDQGMLG
PKAEDIAQFLHQEDRLDTTQVGEFLGENIKFNKEVMYCYVDQLDFCGRDFVSALRMFLEG
FRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKM
TKEQYIKMNRGINDSKDLPEEYLSSIYDEIAGKKIAMKESKEFSITPKSTKQSVASEKQR
RLLYNMEMEQMAKTAKALMEAVSHAQAPFFSATHLEHVRPMFKLAWTPLLAAFSVGLQDC
DDPEVASLCLEGIRCAIRIACIFSMQLERDAYVQALARFTLLTASSSITEMKQKNIDTIK
TLITVAHTDGNYLGNSWHEILRCISQLELAQLIGTGVKTRYISGVVRDREGGIKGLPSGT
EEFMPLGLGNLVGSQDKRQMAHIQESVGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRW
LCAVSMDELASAHQPRMFSLQKIVEISYYNMNRIRLQWSRIWQVIGDHFNKVGCNPNEDV
AIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRDMVIRCVAQMVNS
QAANIRSGWKNIFSVFHQAASDHDETIVELAFQTTGHIVLNTFREHFAAAIDSFQDAVKC
LSEFVCNAAFPDTSMEAIRLIRHCAKYVSDRPQALREYTSDDMNVAPGDRVWVRGWFPIL
FELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWHDLFRIVFRIFDNMKLPEQQTE
KTEWMTTTCNHALYAICDVFTQFYEPLSEILLADIFTQLQWCVRQDNEQLARSGTNCLEN
LVILNGEKFSPEVWDITCSCMLEIFQNTSPQALLTWRPAGQDEEAADAKHFDADFDTQSQ
SSYDRALSERGHSQMSSDDTWKGRSNARVSDQRLFAGLLIKCVVQLELIQTVDNIVFYPA
TSKKEDADNMAAAQRDALEESEAEGRESGPDQGMYRHMTSAHLFKLLDCLLESHTFAKDF
NSNNEQRTALWRAGFKGKSKPNLLKQETSSLACSLRILFRMYSDPQLQDSWPDIQTRLLL
VCNEALGYFISLTSESHREAWNSLLMLLLTRTLRLPDDKFKPHASCYYPHLCEMMQFDLI
PELRAVLRRFFLRIGSVFHIAAAHPEGAPARTP
Download sequence
Identical sequences I3IZK3
ENSONIP00000002043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]