SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002316 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002316
Domain Number 1 Region: 218-298
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.06e-26
Family PHD domain 0.00053
Further Details:      
 
Domain Number 2 Region: 435-720
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.22e-16
Family Hect, E3 ligase catalytic domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000002316
Domain Number - Region: 150-206
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000173
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002316   Gene: ENSONIG00000001857   Transcript: ENSONIT00000002317
Sequence length 729
Comment pep:known_by_projection scaffold:Orenil1.0:GL831232.1:2462396:2477935:1 gene:ENSONIG00000001857 transcript:ENSONIT00000002317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKKARRSQETHTNSVQEECCALCRCSDDDPAMFGEKVTLKEHKISVHYFCLLTSCGVYQ
RGEEDEGIFGFLVEDIKQEVRRSTRLTCFGCKKKGACVGCNVRSCRKMVHFPCGRKQMFV
SQFTGLFPSYCPDHSPSQSLCTGLDISLPRSCSICLDSIDPVLSYSILKCPSCHTSWFHR
DCVQRQAHSAGLFFFRCTLCNNKEHFQEEMLRMGIYIPERDASWELEANAYAELLEVYKR
CDALTCLCNNGRTHSAKSGWFEVVRCRLCGSRGTHRKCSGLKLDTKDWACSDCTQATDGK
ASLVRSPQGGPRRSLLSKRHRPSVHSSISCKRPSLPERSGSPEELLQSLVPRLHPPSVQV
EVIGDQALSAGLDLVRRADFDPTQTLSVRFKDIDQTPLPNHLWDSDTAKEYFLKLLMQQI
QECVVFEGPDGSKNLALDSEALREDLYFDVGCLLALSLVHGGPPVGFFSRALYQCLFNYP
ANRPLNVTHMTPDTHFTHQVTRITEAESLEELKEVMAVSWEYLELAGCNRPISSLKEREA
LVEDLVSFTMITRMQLPLQRFREGLQTLGVFDQVQLFPSVFCGIFCEAGDHLTAQTMGQL
FTINFSEQEEKLNRETPVVTFWRHFLLECEVGRSSISLQDLLHFATGSAKLPAVSALSSP
SISFLHPLAPSLLGFKEGRGVDWRDEGLFPQSEPVSKHLLLPVTSSYQAFKSSMEQAISH
HVHLLPTDG
Download sequence
Identical sequences I3J0C6
ENSONIP00000002316 XP_003451255.2.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]