SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002640 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002640
Domain Number 1 Region: 9-135
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.57e-27
Family Hormone receptor domain 0.00027
Further Details:      
 
Domain Number 2 Region: 120-396
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000485
Family Rhodopsin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002640   Gene: ENSONIG00000002118   Transcript: ENSONIT00000002641
Sequence length 413
Comment pep:known_by_projection scaffold:Orenil1.0:GL831140.1:2612085:2630986:-1 gene:ENSONIG00000002118 transcript:ENSONIT00000002641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSVRGIFLTLCLAPAALSSLHPECEYIFQLEKEERHCLQYIAEQENRSTEGCWPFWDAV
TCWPHAVVGETVHRACPAVFSLFRNSTGSVSRNCTTGGWSRPFPPYHVACNVDDDIPETE
ESYFASVKLIYTIGYSISLVVLAVAVLILLLFRKLRCARNFIHIQLFLTFILKAVAVFIK
DATLFSSDDTNHCTLSTFACKASVVFCHYCVMANFFWLLVEAFYLNSLLLSSFYHSRRCL
WGFSLLGWGVPVLFIVLWIGSRVYFEDTECWDINEDSPYWWIIKGPIVVSIAVNFMLFMN
IIRILIQKLNPRLIQFNNSSQYRRLTKSTLLLIPLFGTHYMFFNFLPDYFNVNLRLCIEL
CMGSFQGLLVAILYCFLNQEVQKEVHMQWLRWQERSYGVVSPAPKGSQMDTPF
Download sequence
Identical sequences I3J1A0
ENSONIP00000002640 ENSONIP00000002640 XP_005479148.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]