SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003042 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003042
Domain Number 1 Region: 354-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-65
Family SPRY domain 0.00000514
Further Details:      
 
Domain Number 2 Region: 17-88
Classification Level Classification E-value
Superfamily RING/U-box 1.14e-18
Family RING finger domain, C3HC4 0.0084
Further Details:      
 
Domain Number 3 Region: 138-199
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000214
Family B-box zinc-binding domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003042   Gene: ENSONIG00000002431   Transcript: ENSONIT00000003043
Sequence length 538
Comment pep:novel scaffold:Orenil1.0:GL831169.1:1257515:1259155:1 gene:ENSONIG00000002431 transcript:ENSONIT00000003043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSFLLDMASPASLIAEENFHCSICLSVFTKPVSTPCGHNFCFDCIKAYWDTTDTLISCP
LCKEEFNIRPKLRVNTFIAEMAAKFKKSEESGNGNVLCNICTGARLPALQSCLVCMMSYC
QTHLKPHQKTVALKKHKLIHPVENLESRICKDHGEPLDLFCSMDKMFLCNSCKDRDHKQH
KIVTVEEEALMRKDQLESEKKDARKMIHERQQKICDTVLLLEANKNNAAKALSCSKHVMT
AMVEYIKRSQAELADVIETKQKKKQAEADGLINELEGEIMQITQKSQQLDNISVTDDPFR
FLESYLSLTIIPPQVKDWSDVTLSCDQFKMQEAMASLEATVTREIRMFCDPNFKELRRHA
VELTLDPDTANSYLYISEDGKQVTCGTQRRRVPNKPERFDCVYNVLAREGFTSGRFYYEV
QVKDKTEWVLGVAKQSINRRGDIRLSPKNGYWTIWLRNGNEFTANTDPSVNLHVTEVPEK
IGVFVDYEDGQVSFYDVDKRASIFSFTGCNFTEKIFPFFSPCATNGGKNSAPLIITPV
Download sequence
Identical sequences I3J2F2
ENSONIP00000003042 ENSONIP00000003042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]