SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003624 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003624
Domain Number 1 Region: 840-897
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000811
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 900-952
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000419
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 722-778
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000129
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 4 Region: 608-661
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000759
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 5 Region: 664-721
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000111
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 6 Region: 51-82
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000719
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 7 Region: 782-835
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003624   Gene: ENSONIG00000002894   Transcript: ENSONIT00000003625
Sequence length 1003
Comment pep:known_by_projection scaffold:Orenil1.0:GL831133.1:5249446:5292025:-1 gene:ENSONIG00000002894 transcript:ENSONIT00000003625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCSHFFLYRLSMLLLLLWSDPLDSQHTTDHRKVPQRAEHQEEVRAEHGEIQGSWGVWGLW
SACSRTCGKGVQEQTRPCLPVYTPSQYPSRGAGVQPHHPGRIVSALRPTVPLHRSTARPY
NSSSRGELRKEKENRPGGRRLSYPDKKRVTNIIPGKYGYGRAPYVASLQTDTGQGSKIPR
PHRHRRSVAANSHHPTARGHGSHRLNDPNASSNIHLNSRPYMNARTQHPRNNQIWAPLYQ
PSSANKAEVQQEHHTGSHMSNPKQHQVRPYNPLPSSFCTGEHARYRICNSNACPPSSRHI
RAVQCSSYNNQPFMGRLYEWEPFNEAKGAKKQCELNCRAIGFRFYVRQSERVIDGTPCGQ
NETSLCVAGKCTSLGCDEYLGSGRVVDKCGVCGGDNTTCRLVSGVFKHSLSKIGYHKIVE
IPEGATKINVTEMVKSRNYLALRSRSGRSIINGNWAIDWPGKYEGAGTMFTYRRPNEISS
TAGESFRAEGPTNEILDVYMIFQQPNPGVHYEYILPSEKLVSPQQPSHRPEGKEDPLLAP
PTVYKRPSKQPVEKITFSLGNAVNGEDGYDQQNHQENFNSAGSGRYSPPPTENQVPSVQP
PRREREYNWKVTGATECSASCGKGFRYSIFHCVNRLTQVQVSDSLCDSSSPQEEACNLQP
CPAFWDIGEWSECSKTCSLGMQHRQVLCRQVYANRTLNVHTSRCRHLERPETASTCRLKI
CSEWQIRSEWTSCSVPCGLGQRSREVHCVSNVGDFVPDEECNMNLRPNDVENCDMGTCAK
SWFYTEWGNRCSAECGMGVRTRGVLCLTNQISSLPLEGCGSERPADSQVCNNGPCENRIE
WFTGPWSQCSVECGTGTQQRSVVCLMKSNEGFTVMPPYECSSLDKPLSQQSCSLKACGAK
WYHTDWSACSKTCEGGFRVREVRCLSDDMLSSEGCDVQLKPEEKEGCNPEPCIPQIDENC
RDKYFNCNVVVQARLCVYDYYKTTCRASCSRVAHKQSTYCLQS
Download sequence
Identical sequences I3J434
ENSONIP00000003624 ENSONIP00000003624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]