SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003867 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003867
Domain Number 1 Region: 622-909
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-82
Family Protein kinases, catalytic subunit 0.00000000386
Further Details:      
 
Domain Number 2 Region: 26-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-70
Family Ephrin receptor ligand binding domain 0.00000205
Further Details:      
 
Domain Number 3 Region: 325-536
Classification Level Classification E-value
Superfamily Fibronectin type III 2.25e-32
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 4 Region: 914-987
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.72e-19
Family SAM (sterile alpha motif) domain 0.00042
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000003867
Domain Number - Region: 256-328,363-387
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000174
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003867   Gene: ENSONIG00000003089   Transcript: ENSONIT00000003868
Sequence length 992
Comment pep:known_by_projection scaffold:Orenil1.0:GL831173.1:1271118:1342510:1 gene:ENSONIG00000003089 transcript:ENSONIT00000003868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGGKYCVFLFLLKSILSDPGTSNQVVLLDTTTVLGELDWKTYPVNGWDAITEMDEQNR
PIHTFQVCHVMEPNQNNWLRSGWIQRQAAQRVYVELRFTLRDCNSIPWVSGTCKETFNLF
YLQTDGPLPDSTRFRPTDYAKVDTIAADESFTQTDLGDRVLRLNTEVREVGPITQKGFYL
AFQDVGACIALVSVKVFYKRCPSTLRNLAAFPETVPQMDSSSLVEVRGSCVENAEERDTP
KLYCGADGDWLVPLGRCVCSIGHEEMDGYCQACKPGFFKAYAGNTKCSKCPLHSSSHDQA
ATICHCDKGFYRALKDPTTMACTRPPSAPRNLVSLINDTALFLQWMPPSDTGGRKDITYN
ILCQRCGGSDSSSAVTQCEPCEPDLHFIPRPLGITGTSVAILDFAMHANYTFHVEAVNGV
SGLGTTARSLANVTVTTHQAGPALVGVVRKDWASQNSIALSWSEVEKPPSDIVDYEVKYY
EKEQEQLSYSSTRTKAPSVVVTGLRPSTVYVFHVRARTAAGYTAYSPNFEFATAAEDPDI
ADQGQVLVVVTASVGGFSLLVILTLFLLITGRCQGYIKARMKSEEKRRTRFHSGHVPFSG
IKTYVDPDTYEDPTQAVEEFAKEINPSYICIERVIGAGEFGEVCSGRLRVPGRMDISVAI
KTLKGGYMDQQRRDFLREASIMGQFNNPNIIRLEGVVTNSRPIMIVVEYMENGALDSFLR
ARDGQFTVLQLVGMLRGIAVGMTYLSDMGYVHRDLAARNILVDENLVCKVSDFGMSRVLE
DDTEAAYTATGGKIPIRWTAPEAIAYGKFSSASDVWSYGIVMWEVMSYGERPYWEMSNQD
VILSIEEGYRLPAPMGCPVTLHQLMLHCWQKEYGQRPHFSDVLSFLDKLIINPSGLLNLA
NDVQSFADSPDDMPDYPLFISIGDWLDSIKMSQYKNNFLAAGYTTLDSISIMSIDDIRRI
GVCLIGHQRRIISSIQSLRLQLHHIQQSGFQV
Download sequence
Identical sequences I3J4S7
XP_005466959.1.78416 ENSONIP00000003867 ENSONIP00000003867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]