SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003868 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003868
Domain Number 1 Region: 587-882
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-82
Family Protein kinases, catalytic subunit 0.00000000386
Further Details:      
 
Domain Number 2 Region: 1-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.79e-61
Family Ephrin receptor ligand binding domain 0.00000483
Further Details:      
 
Domain Number 3 Region: 277-488
Classification Level Classification E-value
Superfamily Fibronectin type III 2.09e-32
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 4 Region: 882-955
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.72e-19
Family SAM (sterile alpha motif) domain 0.00042
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000003868
Domain Number - Region: 208-280,315-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000166
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003868   Gene: ENSONIG00000003089   Transcript: ENSONIT00000003869
Sequence length 960
Comment pep:known_by_projection scaffold:Orenil1.0:GL831173.1:1300225:1340144:1 gene:ENSONIG00000003089 transcript:ENSONIT00000003869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDAITEMDEQNRPIHTFQVCHVMEPNQNNWLRSGWIQRQAAQRVYVELRFTLRDCNSIPW
VSGTCKETFNLFYLQTDGPLPDSTRFRPTDYAKVDTIAADESFTQTDLGDRVLRLNTEVR
EVGPITQKGFYLAFQDVGACIALVSVKVFYKRCPSTLRNLAAFPETVPQMDSSSLVEVRG
SCVENAEERDTPKLYCGADGDWLVPLGRCVCSIGHEEMDGYCQACKPGFFKAYAGNTKCS
KCPLHSSSHDQAATICHCDKGFYRALKDPTTMACTRPPSAPRNLVSLINDTALFLQWMPP
SDTGGRKDITYNILCQRCGGSDSSSAVTQCEPCEPDLHFIPRPLGITGTSVAILDFAMHA
NYTFHVEAVNGVSGLGTTARSLANVTVTTHQAGPALVGVVRKDWASQNSIALSWSEVEKP
PSDIVDYEVKYYEKEQEQLSYSSTRTKAPSVVVTGLRPSTVYVFHVRARTAAGYTAYSPN
FEFATAAEDPDIADQGQVLVVVTASVGGFSLLVILTLFLLITGRCQGYIKARMKSEEKRR
TRFHSGHGGPVMAQKQNKPKIPFSGIKTYVDPDTYEDPTQAVEEFAKEINPSYICIERVI
GAGEFGEVCSGRLRVPGRMDISVAIKTLKGGYMDQQRRDFLREASIMGQFNNPNIIRLEG
VVTNSRPIMIVVEYMENGALDSFLRARDGQFTVLQLVGMLRGIAVGMTYLSDMGYVHRDL
AARNILVDENLVCKVSDFGMSRVLEDDTEAAYTATGGKIPIRWTAPEAIAYGKFSSASDV
WSYGIVMWEVMSYGERPYWEMSNQDVILSIEEGYRLPAPMGCPVTLHQLMLHCWQKEYGQ
RPHFSDVLSFLDKLIINPSGLLNLANDVQSHVSFADSPDDMPDYPLFISIGDWLDSIKMS
QYKNNFLAAGYTTLDSISIMSIDDIRRIGVCLIGHQRRIISSIQSLRLQLHHIQQSGFQV
Download sequence
Identical sequences I3J4S8
ENSONIP00000003868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]