SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004163 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004163
Domain Number 1 Region: 644-950
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.92e-82
Family Protein kinases, catalytic subunit 0.00000000165
Further Details:      
 
Domain Number 2 Region: 29-200
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-72
Family Ephrin receptor ligand binding domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 326-372,421-565
Classification Level Classification E-value
Superfamily Fibronectin type III 1.49e-41
Family Fibronectin type III 0.0000193
Further Details:      
 
Domain Number 4 Region: 945-1020
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.86e-19
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000004163
Domain Number - Region: 245-319
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0848
Family Growth factor receptor domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004163   Gene: ENSONIG00000003310   Transcript: ENSONIT00000004164
Sequence length 1023
Comment pep:known_by_projection scaffold:Orenil1.0:GL831180.1:4027812:4172295:1 gene:ENSONIG00000003310 transcript:ENSONIT00000004164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDPGLAAMLLWTISLQAVGTSGTNSNEVNLLDTTTITGDWGWLTYPSHGWDAINEMDE
YFSPIHTYQVCNVMSPSQNNWLVTGWIPREGARRIYIEVKFTLRDCNSMPGVLGTCKETF
NLYYYESDRAVGSAIRENQFIKIDTIAADESFTGVDLGVRRLKLNTEVRGVGPLNRRGFY
LAFQDIGACIALTSVRVYYKRCVGVNRNLAVFTDVVTGADSSSLVEVRGQCVDHAEERDT
PKMYCSAEGEWLVPIGRCVCSAGFEEHRDSCIACEVGFYKPVAGDGLCGKCPQHSHSETR
AALSCPCDTNYYRAADDTPAAPCSRPPSAPVNVISSVNGTSVNLEWDRPLDTGGRSDLQY
NVLCMKCLGEGGPCEDCSSSPGGITGGGKAGGGASAGAGGGGMVERSGTAAVRFVPRQTG
LKESWVTVLNLVAHTNYSFRILAMNAVSHLTNEPTPYAVVNITTNQAAPSEVLAIRQENT
SQNSVTLLWHEPDQPNGVILEYDIKYYEKDNEEHSYSTLKSKNTSARVSGLKPGTKYIFQ
VRARTSAGCGRFSQNIEIQTGKAVPLRYNTMTIIWICMALVSGLVTFLAIIICRKRHCGY
SKAFQDSDEEKMHYQNGHVSFPDARFYIDPHTYEDPCQAVHEFAREIEASRIKIEKIIGS
GEFGEVCYGRMRLPGKRDIPVALKTLKAGYTEKQKRDFLAEASIMAQFDHPNVIRLEGVV
THSKPVMIITEYMENGSLDSFLRRHDGQFTIIQLVGLLRGIAAGMTYLSDLGYIHRDLAA
RNILVNSNLVCKVSDFGLSRVLEDDPDAAYTTSVSFHIEGGKIPIRWTAPEAIAYRKFSS
SSDVWSYGVVMWEVMSYGERPYWNLTNRDVIKSVEEGYRLPAPMGCPAALHTLMLDCWQK
DRNERPRFCQIVTVLDKLIRNPENLKSMDTLCSLNSPTLMERAIPDFSSCNSVDEWLDTI
KMSRYKEHFAAGGYHTLGHVISMNQGDIQRLGVTLMGHQKKIMTSVQLMRAQVLNKSVPS
VHV
Download sequence
Identical sequences I3J5M3
XP_005452316.1.78416 ENSONIP00000004163 ENSONIP00000004163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]