SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004164 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004164
Domain Number 1 Region: 569-869
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-83
Family Protein kinases, catalytic subunit 0.00000000156
Further Details:      
 
Domain Number 2 Region: 2-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.25e-64
Family Ephrin receptor ligand binding domain 0.00000327
Further Details:      
 
Domain Number 3 Region: 277-485
Classification Level Classification E-value
Superfamily Fibronectin type III 6.15e-43
Family Fibronectin type III 0.0000193
Further Details:      
 
Domain Number 4 Region: 864-939
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.68e-19
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000004164
Domain Number - Region: 196-270
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0667
Family Growth factor receptor domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004164   Gene: ENSONIG00000003310   Transcript: ENSONIT00000004165
Sequence length 942
Comment pep:known_by_projection scaffold:Orenil1.0:GL831180.1:4087622:4167856:1 gene:ENSONIG00000003310 transcript:ENSONIT00000004165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQWDAINEMDEYFSPIHTYQVCNVMSPSQNNWLVTGWIPREGARRIYIEVKFTLRDCNSM
PGVLGTCKETFNLYYYESDRAVGSAIRENQFIKIDTIAADESFTGVDLGVRRLKLNTEVR
GVGPLNRRGFYLAFQDIGACIALTSVRVYYKRCVGVNRNLAVFTDVVTGADSSSLVEVRG
QCVDHAEERDTPKMYCSAEGEWLVPIGRCVCSAGFEEHRDSCIACEVGFYKPVAGDGLCG
KCPQHSHSETRAALSCPCDTNYYRAADDTPAAPCSRPPSAPVNVISSVNGTSVNLEWDRP
LDTGGRSDLQYNVLCMKCLGEGGPCEDCSSAVRFVPRQTGLKESWVTVLNLVAHTNYSFR
ILAMNAVSHLTNEPTPYAVVNITTNQAAPSEVLAIRQENTSQNSVTLLWHEPDQPNGVIL
EYDIKYYEKDNEEHSYSTLKSKNTSARVSGLKPGTKYIFQVRARTSAGCGRFSQNIEIQT
GKAVPTSDIHNGQSEHVLLHAVSGCWISVITFHAWFFIANRKSSYSKAFQDSDEEKMHYQ
NGHVSFPDARFYIDPHTYEDPCQAVHEFAREIEASRIKIEKIIGSGEFGEVCYGRMRLPG
KRDIPVALKTLKAGYTEKQKRDFLAEASIMAQFDHPNVIRLEGVVTHSKPVMIITEYMEN
GSLDSFLRRHDGQFTIIQLVGLLRGIAAGMTYLSDLGYIHRDLAARNILVNSNLVCKVSD
FGLSRVLEDDPDAAYTTSGGKIPIRWTAPEAIAYRKFSSSSDVWSYGVVMWEVMSYGERP
YWNLTNRDVIKSVEEGYRLPAPMGCPAALHTLMLDCWQKDRNERPRFCQIVTVLDKLIRN
PENLKSMDTLCSLNSPTLMERAIPDFSSCNSVDEWLDTIKMSRYKEHFAAGGYHTLGHVI
SMNQGDIQRLGVTLMGHQKKIMTSVQLMRAQVLNKSVPSVHV
Download sequence
Identical sequences I3J5M4
ENSONIP00000004164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]