SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004196 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004196
Domain Number 1 Region: 451-627
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.44e-51
Family SPRY domain 0.00065
Further Details:      
 
Domain Number 2 Region: 14-83
Classification Level Classification E-value
Superfamily RING/U-box 8.39e-18
Family RING finger domain, C3HC4 0.0094
Further Details:      
 
Domain Number 3 Region: 147-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000147
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004196   Gene: ENSONIG00000003334   Transcript: ENSONIT00000004197
Sequence length 629
Comment pep:known_by_projection scaffold:Orenil1.0:GL831194.1:839143:847622:1 gene:ENSONIG00000003334 transcript:ENSONIT00000004197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVDESQFSIMSLEDELTCSICLSTFDCPVTIPCGHNFCQDCLLATWKESYSCPQCRTL
FATRPELKKNTVLTAVVETFKVRSSKSEPNLAAEESQVKKKEIIRCDTCMEAEASKTCFT
CMASYCEEHLRPHRENPIFRLHSLSEPVGDLLERICPDHHKLMELFCSQHDRPICSFCLQ
QVHKGCSFTTPDEQRSRKESDLRSNLGLLDGKIVKNETIIFEMKDMQNKLKDLATSRKRA
LTAEYQQMREMLVQDERDALNAVDREVETGQTKLRVLMKKFGDNIDNMTKAKEEIHSLLS
RSQTQAFLQAPFNLPQAINFEPYSPKISLDSKKVLASQAFAAALKQHLTELFKQPVESRL
PLNTPGECMDTFFNPGPQAKTGQKKKTPKPKPKNPQTTGDGMGDKTTGRSMENLLEFGGK
PRGRTPAAEPKQKPETTDIPPDISTAEKRCELLKYGTVLTFNPRTAHKRIALTENFTKAS
VSDEHINYPDCPERFAVCSQVLASKGFSTGRHYWEVRLSSSNFVGIGLAYNSIDRKGPTS
RLGRNAQSWCVEWFNVKLSVWHNSSETVLVNPNPKRVGVLLDCEAGTATFYNVADRAYPF
HSFMFPFAQAVYPAFWIFSSGSSITLCKL
Download sequence
Identical sequences I3J5Q6
ENSONIP00000004196 ENSONIP00000004196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]