SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004201 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004201
Domain Number 1 Region: 483-665
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.68e-48
Family SPRY domain 0.00071
Further Details:      
 
Domain Number 2 Region: 14-83
Classification Level Classification E-value
Superfamily RING/U-box 9.28e-18
Family RING finger domain, C3HC4 0.0094
Further Details:      
 
Domain Number 3 Region: 146-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000168
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004201   Gene: ENSONIG00000003338   Transcript: ENSONIT00000004202
Sequence length 668
Comment pep:known_by_projection scaffold:Orenil1.0:GL831194.1:852740:864472:1 gene:ENSONIG00000003338 transcript:ENSONIT00000004202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVDESQFSIMSLEDELTCSICLSTFDCPVTIPCGHNFCQDCLLATWKESYSCPQCRTL
FATRPELKKNTVLTAVVETFKVRSSKSEPNLAAEESQVKKKEIIRCDTCMEAEASKTCFT
CMASYCEEHLRPHRENPIFRPHQLSEPVGDLLERICSDHHKLKEFFCSQHDRLICSFCLQ
QVHKGCSFISPEEQRNLKESDLRDKLGLLNEKMEKTETVVFQINTMQSKLKDGANKRKTA
LAAVYQQMRDILAQDEREAQTEVDRELELGQMKLRDLMKKLDENYNKMGKAREHINKLLS
QSQSMAFLQASAELPKVVKIEPQMPPINLDSRKMIAMQSFAAALRETLMEMLKQPTEARL
QLFKPVMCAGQTAAVSGPARTESTGAQPELEVECCPGQSRLPESDSPGPQAQKAKKKRTR
KTKTKPNESTGDIMRIKKNARSMENLLEYGVKEKPRDCSPAAEPKQKPEAPDIPPDISTA
EKRSELLKYGTELTFDPRTAHKRIVLTENFTKASVSDVHINYPDCPERFAVCSQVLTSEG
FSTGRHYWEVRLTNINFVGIGLAYNSIDRKGPTSRLGRNAQSWSVEWFDVGLSVWHNSSE
TVLVNPNPKRVGVLLDCEAGTATFYRVAERVYPFHTIKFPYPAFLEAIYPAFWIFSNGSS
ITFCKMQP
Download sequence
Identical sequences I3J5R1
ENSONIP00000004201 XP_019215102.1.78416 ENSONIP00000004201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]