SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005451 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005451
Domain Number 1 Region: 571-648,692-910
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.05e-80
Family Protein kinases, catalytic subunit 0.00000000218
Further Details:      
 
Domain Number 2 Region: 5-156
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-65
Family Ephrin receptor ligand binding domain 0.00000373
Further Details:      
 
Domain Number 3 Region: 281-486
Classification Level Classification E-value
Superfamily Fibronectin type III 1.39e-32
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 4 Region: 910-980
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.34e-19
Family SAM (sterile alpha motif) domain 0.00052
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000005451
Domain Number - Region: 210-278,314-333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00345
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005451   Gene: ENSONIG00000004324   Transcript: ENSONIT00000005455
Sequence length 987
Comment pep:known_by_projection scaffold:Orenil1.0:GL831170.1:2220673:2353069:1 gene:ENSONIG00000004324 transcript:ENSONIT00000005455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TYEVSGWDAITEMDEHNRPIHTFQVCNVMEPNQNNWLRSNWISRQAAQKVYVELRFTLRD
CNSIPWVSGTCKETFNLFYHETDEAHGVKFRPAQYTKIDTIAADESFTQMDLGDRILKLN
TEVREVGPINRKGFYLAFQDIGACIALVSVRVYYKKCPFTLRNLASFPDTVPRVDSSSLV
EVRGACVDHAEERDTPKLFCGADGDWLVPLGRCVCSVGYEEIDGSCVACRPGFYKAYAGN
IKCSKCPPHSFSYGDASAICRCEKGFFRAEKDPPTMACTRPPSPPRNLIFNLNDTCLLLE
WSPPSDTGGRRDLTYNVQCKRCGPEPDHCQLCEDELRFLPGPLGLTNATVTVLDFSAHAN
YTFEIESLNGVSDMSSFPRQVAIITVSTDQGGPSLVGTLKKDWASPNSIALSWQQPEQTT
LPIIDYEVKYYEKEHELLSYSSTRTKAPSVIVSGLKPATWYVFSVRTRTAAGYSSYSPKY
EYETTGDSSNMASDQGQVLVIVTAAVGGFTLLVILTLFLLITGRCQWYFKAKMTSEDKRR
ANYQNGHVPFPGIKTYVDPDTYEDPTQAVHEFTKEIDPSRIRIERVIGAGEFGEVCSGRL
RTPGKKEIAVAIKTLKGGYVERQRRDFLREASIMGQFDHPNIIRLEGVVTKKRKKTSPNS
FAVCYSLRQAGAFVFVQALHCITIYCFQTLLISSGRPVMIVVEYMENGSLDSFLRQHDGH
FTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEA
AYTTTGGKIPIRWTAPEAISYRKFSSASDAWSYGIVMWEVMSYGERPYWEMSNQDVILSI
EEGYRLPAPMGCPVALHQLMLHCWQKERNHRPKFTDIVSFLDKLIRNPSSLLPLVEDIQS
LPESPGEEMDYPMFISVGDWLDSIKMSQYKSNFMAAGYNTLDSVARMSIEDVRRIGVELI
GHQRRIISSIQTLHLQLLHEHEKGFHV
Download sequence
Identical sequences I3J9B1
ENSONIP00000005451 ENSONIP00000005451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]