SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005989 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005989
Domain Number 1 Region: 198-364
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-40
Family Dual specificity phosphatase-like 0.0000113
Further Details:      
 
Domain Number 2 Region: 374-510
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.86e-32
Family PLC-like (P variant) 0.003
Further Details:      
 
Domain Number 3 Region: 58-190
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000118
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005989   Gene: ENSONIG00000004760   Transcript: ENSONIT00000005993
Sequence length 512
Comment pep:known_by_projection scaffold:Orenil1.0:GL831183.1:948314:953324:-1 gene:ENSONIG00000004760 transcript:ENSONIT00000005993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVYFNPGSDSSVNGNITKMENAKVEIDDGKEESALPDTLYYNLRKKIAPFVMSFGFRL
FGVILIIVDFVLVIVDLSLPAKSRDAGNALEAVSLTISFFFLADVLLRVYVEGFKVYFSS
KLNIIDACVVIVTLAVTMVYTFSDLSGTSLIPRVVTFLRFLRIIILVRVFRLAAQKKELE
KVTRRMISENKRRYQKDGFDLDLTYVTDRVIAMSFPSSGKQAFYRNPIREVARFLDTKHE
GHYKVYNLCSEKGYDPQFFHYRVERVFIDDHNVPSLEDMLKYTASVREWMSADPQNIIAI
HCKGGKGRTGTMVCTWLIDSDQFESAQDSLEYFGERRTDKSQSSKFQGVETPSQSRYVGY
YEIMKNKLNRQLPPPKSLRIKSIRIHSIAGVGKGNGSDFKVKIVVRKELVFECVCAKQEN
CTVFPDVGNNAAVISLQNGPVVEGDVKVMFESSAGLPKGYEDVPFYFWFNTSFIEDNKLF
LPREELDNPHKPKTWDLYKEDFGVTMYFSESE
Download sequence
Identical sequences I3JAU9
ENSONIP00000005989 ENSONIP00000005989 XP_003446945.1.78416 XP_005472300.1.78416 XP_005472301.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]