SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006024 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006024
Domain Number 1 Region: 146-392
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-89
Family Protein kinases, catalytic subunit 0.000000000846
Further Details:      
 
Domain Number 2 Region: 2-110
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-25
Family Pleckstrin-homology domain (PH domain) 0.00000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006024   Gene: ENSONIG00000004786   Transcript: ENSONIT00000006028
Sequence length 392
Comment pep:known_by_projection scaffold:Orenil1.0:GL831202.1:3459868:3486159:1 gene:ENSONIG00000004786 transcript:ENSONIT00000006028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSIVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPDLNDQTSPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVESNEEREGWIRAIQYVANSLKMQEQGEEEP
MDVLSSPNESSLVEMEAVMSKSRTKVTMSDFEYLKLLGKGTFGKVILVKEKTTGVHYAMK
ILRKMVIIAKDEVAHTVTESRVLQNTKHPFLTTLKYAFQTHDRLCFVMEYANGGELFFHL
SRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
TPDATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFEL
ILMEEIRFPRNLSPEAKSLLAGLLKKDPKHRY
Download sequence
Identical sequences I3JAY4
ENSONIP00000006024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]