SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006364 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006364
Domain Number 1 Region: 312-619
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-46
Family Kelch motif 0.0015
Further Details:      
 
Domain Number 2 Region: 47-162
Classification Level Classification E-value
Superfamily POZ domain 1.57e-30
Family BTB/POZ domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006364   Gene: ENSONIG00000005060   Transcript: ENSONIT00000006369
Sequence length 633
Comment pep:known_by_projection scaffold:Orenil1.0:GL831147.1:1283646:1291165:1 gene:ENSONIG00000005060 transcript:ENSONIT00000006369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDENQDLSLCLTNTHNPCSSNSPPSSRPGSAPQCNGVAERRTMLRVSESHGLQLLGMLRS
LRERGLLFDFTIKVQERSFPCHRCVLAACSDFFRAMFEVDMRERDDGSVTLGNQCPAVVA
SFLDFAYSGEVLITEGNVDMLFQLASFLQVSVLSKACSDFLIGTMDLYNCLSLLSLAEGY
GSASLLQSANEFVVQNFFELSKTQDFLDMQVDVLELCLRSDALNVPSEEAVVVSLLRWIR
HDLPGRQKLLPGLLSLTRLHHLPAPALKSLCDSDPLLCNDESCLALASEAQSRQTKHNGL
LTDARPATTQSYIYIHKTEENGEIRHTFCYCLETDQWKELGAGQEEGTATMPDPPGSYLT
SYAEKMFVTGGCQGNCCRAIRLHVAEPFHDATDEVWCFCPVTLTRTPAPAMLKPRTMHTA
VTCLDRVYVIGGRTKGSRGGAPSLLEVEYYNPLAQTWCSVSPLPTAIFYPEASACGSVIY
TLGSEVEITDSFNPSLDCFFCYDALQDQWSRLVAEFGQFFHATLVKAVSINKTLHLCDLS
TYKVYSFCPETCVWKGEGSFECAGFNAGAVGMRDRIYILGGDYSPDEITDEVQVYYSGRS
QWEEVAPMPKALTEFHCQLISFNRYRDPWCDTA
Download sequence
Identical sequences I3JBX4
ENSONIP00000006364 XP_003441688.1.78416 XP_005474715.1.78416 XP_005474716.1.78416 XP_005474717.1.78416 ENSONIP00000006364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]