SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006516 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006516
Domain Number 1 Region: 148-459
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.88e-99
Family Protein kinases, catalytic subunit 0.0000000000347
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-24
Family Pleckstrin-homology domain (PH domain) 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006516   Gene: ENSONIG00000005187   Transcript: ENSONIT00000006521
Sequence length 482
Comment pep:known_by_projection scaffold:Orenil1.0:GL831147.1:2540772:2546270:-1 gene:ENSONIG00000005187 transcript:ENSONIT00000006521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSVVREGWLHKRGEYIKTWRPRYFILKSNGSFIGYKEKPEVSSDHNLPPLNNFSVAE
CQLMKTERPKPNTFVIRCLQWTSVIERTFHVDSNEEREEWMRSIQAVANSLKSQQQDEEP
MEIKFGSPSDSSGMEDMEIAVSKSRTKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFF
HLSRDRVFTEDRARFYGAEIVSALEYLHSRNVVYRDLKLENLMLDKDGHIKITDFGLCKE
GITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEEIRFPKNLAPEAKALLAGLLKKDPKQRLGGGPDDAKEVMSHKFFTSINWQDVID
KKLIPPFKPHVTSETDTRYFDDEFTAQSITITPPDKYDSLDVEDSDQRTHFPQFSYSASI
RE
Download sequence
Identical sequences I3JCC6
XP_003441636.1.78416 XP_013124794.1.78416 XP_019222860.1.78416 ENSONIP00000006516 ENSONIP00000006516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]