SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006537 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006537
Domain Number 1 Region: 616-892
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-79
Family Protein kinases, catalytic subunit 0.00000000075
Further Details:      
 
Domain Number 2 Region: 28-200
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.38e-63
Family Ephrin receptor ligand binding domain 0.000000906
Further Details:      
 
Domain Number 3 Region: 328-536
Classification Level Classification E-value
Superfamily Fibronectin type III 1.5e-34
Family Fibronectin type III 0.00033
Further Details:      
 
Domain Number 4 Region: 914-979
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.95e-20
Family SAM (sterile alpha motif) domain 0.00083
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000006537
Domain Number - Region: 249-321,366-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000169
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006537   Gene: ENSONIG00000005204   Transcript: ENSONIT00000006542
Sequence length 984
Comment pep:known_by_projection scaffold:Orenil1.0:GL831183.1:3241757:3259316:1 gene:ENSONIG00000005204 transcript:ENSONIT00000006542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRPQAWRVAGNWGEMGGIKTNMRVSSAEVLMNTKTETSDLKWTVFSHARPQWEEVSGLDE
ENNSVRINQICQTDSSSSHWLRSGYIQRRGASQVYVELRFTMMECSSRSTHHRSCKETFN
LYYYEADSNEATATNPPWMENPYIKVDTVAADFLLRKDGEKKLNVKTLRLGPLNKRGFYL
AFQAQGACMALLSVRVFFKKCPPLVSALSSFPETIPRTLVQEAQGVCVEHAAQQGPRPRP
PKLFCGEDGQWVGQPTTSCACVPGFEPAEGYTRCTACPVGQFKSGVEGQCRGCPGFSQAT
NRGASVCECRPGYLRAESDTPDTPCTRTPSAPRSIIPKVNFTTVTLDWNEPLDSGSRNDL
SYAVRCSLCRSPKETCLPCGDGVSYRPAKDGLLGHRVEVWGLLPHTTYTFTIQALNGVSQ
LSEKEPASESVNITTSHDVPPLVSVIRKSDSTESSLTLHWSVPTQPHYTILQYELRYCEK
KEQRSEDQCHSIQSNRNQAVLTDLRRASQYEVQVRARTQAGYGSFSPPIIFRTLPDGRDS
GSEFLVPGIFIAVGMLLLVTFVFVAAYCIRRHSRIKDPELSDKNSQYLIGQGVKVYIDPF
TYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVCRGRLKIPGKKENYVAIKTLKGGYT
DKQRRDFLSEASIMGQFQHPNIIHLEGIITASCPVMILTEYMENGALDSFLRLNDSQFTP
IQLVGMLRGIASGMKYLAEMSYVHRDLAARNILINSNLVCKVSDFGLSRFLQENSSDPTY
TSSLGGKIPIRWTAPEAIAFRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIE
QDYRLPPPPDCPTHLHQLMLDCWQKDRSARPRFAELVSALDKLIRNPASLKIVAQEGAGP
SYPLLDQRAPLALPPCASVGDWLRAIKMERYEDSFLQAGFNSVDQLAQITTQDLLHMGVT
LAGHQRKILSSIQTMTFQNKSTAT
Download sequence
Identical sequences I3JCE7
ENSONIP00000006537 ENSONIP00000006537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]