SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007279 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007279
Domain Number 1 Region: 8-133
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.27e-23
Family Hormone receptor domain 0.00029
Further Details:      
 
Domain Number 2 Region: 116-396
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000531
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007279   Gene: ENSONIG00000005778   Transcript: ENSONIT00000007284
Sequence length 442
Comment pep:known_by_projection scaffold:Orenil1.0:GL831138.1:114965:164639:1 gene:ENSONIG00000005778 transcript:ENSONIT00000007284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSAQLLLLVLCGYLPKVLSVQMCDVVNEIQLEKERCENSTSGNVTSGCQGMWDIIACWP
SARVGEVVTITCPPYFSYFSDHQKGNLSKTCTEDGWTEMHPIDIAVSCGYNLNSTSDDGK
FFWQVKIGYTIGHSVSLVSLTTAIVILCIFRKLHCTRNYIHMHLFVSFILKAIAVFIKDV
VLYEVGEVDNCSSGSVGCKAVIVFFQYCIMASFFWLLVEGLYLHALLAVSFFSERKYFWA
YILIGWGGPAIFITAWSIAKANYNDVGCWDIIENTDVFWWIIKTPILASILMNFILFICI
IRILRQKINCPDIGRNDSNQYSRLAKSTLLLIPLFGINYIVFAFIPEQVKTELRLVFDLI
LGSFQGFVVAVLYCFLNGEVQGEIKRKWRRWHLQRYMGSDTKYQHPSIGSSNNFSTQITM
LTRCSPKTRRASSSCHDDLSSI
Download sequence
Identical sequences I3JEI8
ENSONIP00000007279 XP_003439239.2.78416 ENSONIP00000007279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]