SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007630 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007630
Domain Number 1 Region: 250-492
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.43e-86
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 153-255
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000314
Family Hepsin, N-terminal domain 0.024
Further Details:      
 
Domain Number 3 Region: 107-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000772
Family LDL receptor-like module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007630   Gene: ENSONIG00000006058   Transcript: ENSONIT00000007635
Sequence length 495
Comment pep:known_by_projection scaffold:Orenil1.0:GL831228.1:1313557:1320247:1 gene:ENSONIG00000006058 transcript:ENSONIT00000007635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGRCDQSQVDKEIGSSVSHTNIPTQSKTRHNREEQGTTAAQLPEETSRPLNPTNPGPRP
GRHRRPMTAPNTPREKRAKIKKVLITTLTVLLILGILAIAAYFIKNLIESKYFFCTRSVK
FIPLDKTCDGHIDCAGAEDEITCMTTFKVNTTFPVRLQSNDQVLQVYSPDSGWRTVCADD
WTQAHTQTACTQLGYTMKPTSKNILVSSLMSPMKTGPFTAVRPGTSNTPIQQATADRSVC
NSGSVVSLSCSDCGKVGPEHRIVGGTDTSIDHWPWQVSLQRSGQHTCGGSLVSPRWVVTA
AHCFTGNNRELRQWAVVSGQTNIITLGGSSVDRVIVNGDYNAETNDYDIALMRLTRPITV
SDIRRPVCLPPKDYIITAGTYMTVTGWGYQRENGAVSDILQEANVPLIAQSACSSYTLYG
SAITNRMLCAGFPEGKVDACQGDSGGPLVHITESNWNLVGVVSWGVGCARKGKPGVYSNV
EMMLNWIQTVIEKHP
Download sequence
Identical sequences I3JFI9
ENSONIP00000007630 XP_005455837.1.78416 ENSONIP00000007630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]