SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007632 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007632
Domain Number 1 Region: 355-492
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-39
Family C-type lectin domain 0.00026
Further Details:      
 
Domain Number 2 Region: 646-786
Classification Level Classification E-value
Superfamily C-type lectin-like 3.75e-37
Family C-type lectin domain 0.000033
Further Details:      
 
Domain Number 3 Region: 796-925
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-34
Family C-type lectin domain 0.0008
Further Details:      
 
Domain Number 4 Region: 1186-1326
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-33
Family C-type lectin domain 0.0004
Further Details:      
 
Domain Number 5 Region: 504-640
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-33
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 6 Region: 225-355
Classification Level Classification E-value
Superfamily C-type lectin-like 8.94e-32
Family C-type lectin domain 0.00053
Further Details:      
 
Domain Number 7 Region: 934-1059
Classification Level Classification E-value
Superfamily C-type lectin-like 1.4e-30
Family C-type lectin domain 0.00064
Further Details:      
 
Domain Number 8 Region: 26-157
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.82e-30
Family Cysteine rich domain 0.0000146
Further Details:      
 
Domain Number 9 Region: 1057-1189
Classification Level Classification E-value
Superfamily C-type lectin-like 7.42e-30
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 10 Region: 157-215
Classification Level Classification E-value
Superfamily Kringle-like 2e-19
Family Fibronectin type II module 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007632   Gene: ENSONIG00000006060   Transcript: ENSONIT00000007637
Sequence length 1420
Comment pep:known_by_projection scaffold:Orenil1.0:GL831138.1:2483134:2498889:-1 gene:ENSONIG00000006060 transcript:ENSONIT00000007637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVLLLFMITSTWCGLTQMLISAPDTSSFLIFNEDHNKCVKVESATSITVAACDPHAKDQ
QFRWVSESRLLSLSLKLCLGTTAIKDWVKVQLMECDESNDLQHWQCKNDTLFGLKDQDLH
LNWGNRNEKSVMIYKGSGIWSRWRIYGTQGDLCSKGYQEIFTLGGNAFGAACQFPFKFHK
KWYAECTKDGRTDGQLWCATERDYDKLGKWGFCPTRGKGNKTSSNWVTDPVTGVQYQLNA
QSVLTWYQARKSCQQQGADLLSIVELHEQSYISGLANHLGSSLWIGLNSLDFDSGWQWSN
GNPFRYLNWAPGHPSSNSGLNCATLNAAKASKWESSVCSKKLGYICRKGNTTSLPSPSTK
QPGFCPNHWVHYAGNCYYLVRTAEMWSNALAACRKEGGDLASIHNIEEQSFIISQSGYMP
TDVLWIGLNDQKNQMLFEWSDHSHVTFTQWQSDEPSHFTSFREDCVLIQGKDGKWADHTC
EKSHGYMCKKKASAKPIGGSLAEVNKGCTLGSIRFGSYCYNIGAEKKTFEEAKQACSGAG
ANLVDVSDRYENAFLVSLVGLRPEKYFWTGLSNTEDRNTFKWTTERAVTFTHFNVGMPDR
KQGCVAMTTGVFAGLWDVVSCSNKEKYICKKRAEGVQTTTAPPTTLAATCASQWTPVGKG
NKCLKVYKKNQEEKKTWSEARDFCRAIGGDLISLHSHQEWRQLNFLYYSEKFWIGLSLQG
TNGGFVWSDGSPLDFEYWNYGEPNNHNDNEHCTEMDSNLRMRWNDRHCDAYNSWICQLSK
GVTPNPEPVISVQAEYNTTDDGWLLYNDSQYYVNMNKQSMEAARAYCKKNFGELVVITGE
SERKFLWKQISRGTQGQYYIGLIVNLDKSFSWLDGTPVTYTAWEHNEPNFANNDENCVTM
YNSMGYWNDINCGIELPSICKRSNSFINTTMAPTTAPXARTHCINQGGNLLSITSEKEQA
FLTTQMLNYKEDFWIGMNDVNWDMRFVWTDGKSISYTNWALGEPASAPPGRYFHESYDCV
IMIGTSARKTGYWKVADCQSEYGFICKRKIDSQIAVKPTTVSPKTFYKLGNDSYKVVTQK
MRWDEARRQCQADDAELASILSPVSHAYATLQILKLNEPLWIGLNSNVTGFHFKWVDNWA
LSYTKWGKNEPKHNYACVYVDVDKTWKTAPCTNTYYSLCKRSPVVAPSAPPQLPGDCPQS
TSRRTWIPFRGHCYSFFSSVTDDWARASLDCIQMGASLVSIQDPIESKFIEENVEILQDS
AKTFWIGMYKTHEDKWMWIDNSPLDYTNWNSGMAESESCVYINSYTGLWSTTYCRLSFSY
ICKTPKVIKPTEKPPFVASSAHVIQETTHGSAGIIVAIVLIVIAIVGLGAFLLFRKRIPR
IPALNLRESTFDNKLYFNNPNRAAVDTKGLVANIEQNEQA
Download sequence
Identical sequences I3JFJ1
ENSONIP00000007632 ENSONIP00000007632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]