SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007924 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007924
Domain Number 1 Region: 185-304
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-36
Family Third domain of FERM 0.00051
Further Details:      
 
Domain Number 2 Region: 84-184
Classification Level Classification E-value
Superfamily Second domain of FERM 6.54e-28
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 4-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-22
Family First domain of FERM 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007924   Gene: ENSONIG00000006287   Transcript: ENSONIT00000007929
Sequence length 311
Comment pep:known_by_projection scaffold:Orenil1.0:GL831301.1:733628:745965:-1 gene:ENSONIG00000006287 transcript:ENSONIT00000007929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLRLRVVFLDDSERTFEVEQKVLGGDFYNKVCGHLKLLEKEYFGLEFRHHSGNYVWLELL
KPLVKQIRYTNDLFFRFIVKFFPPDPGQLKRGLTRYLFALQIKQDLSNGSLTCNDNSAAL
LVSHILQSEIGDYDEELDCQHLEMKHYVPNQEYLDHKIIKFHKKHRGLSPANSDIQLLEV
ARKLDMYGIRPYPAYDGEGMRINLAVTHSGVLVFQGNTKINTFSWAKIRKLSFKRKHFLI
KLHDKVGPSCKDTLEFAMASRDVCKSFWKMCVEYHAFFRLAEEPKAIHKTLLSCKGSSFR
YRHELFSNHLL
Download sequence
Identical sequences I3JGD3
ENSONIP00000007924 ENSONIP00000007924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]