SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007925 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007925
Domain Number 1 Region: 102-202
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-28
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 2 Region: 22-102
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.29e-22
Family First domain of FERM 0.002
Further Details:      
 
Domain Number 3 Region: 203-237
Classification Level Classification E-value
Superfamily PH domain-like 0.0000012
Family Third domain of FERM 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007925   Gene: ENSONIG00000006287   Transcript: ENSONIT00000007930
Sequence length 251
Comment pep:known_by_projection scaffold:Orenil1.0:GL831301.1:733701:746019:-1 gene:ENSONIG00000006287 transcript:ENSONIT00000007930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTGRLGNLTTKSRVSKETKLRLRVVFLDDSERTFEVEQKVLGGDFYNKVCGHLKLLEKEY
FGLEFRHHSGNYVWLELLKPLVKQIRYTNDLFFRFIVKFFPPDPGQLKRGLTRYLFALQI
KQDLSNGSLTCNDNSAALLVSHILQSEIGDYDEELDCQHLEMKHYVPNQEYLDHKIIKFH
KKHRGLSPANSDIQLLEVARKLDMYGIRPYPAYDGEGMRINLAVTHSGVLVFQARSCCFS
IKKIHIYINHL
Download sequence
Identical sequences I3JGD4
ENSONIP00000007925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]