SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008137 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008137
Domain Number 1 Region: 1165-1361
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.61e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000232
Further Details:      
 
Domain Number 2 Region: 947-1072
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-29
Family Pleckstrin-homology domain (PH domain) 0.000012
Further Details:      
 
Domain Number 3 Region: 44-167
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-18
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008137   Gene: ENSONIG00000006455   Transcript: ENSONIT00000008142
Sequence length 1983
Comment pep:known_by_projection scaffold:Orenil1.0:GL831138.1:6265035:6366741:1 gene:ENSONIG00000006455 transcript:ENSONIT00000008142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAARWSDSPQDNEERKHRAITPCGKAKQKDGRDQSEASAAASPGADDEPFSWPGPKTLR
LRRTSQGFGFTLRHFIVYPPESAVHNSLKDEENGSRGRQRNRLEPMDTIFVKQVKEGGPA
HGAGLCTGDRIVKVNGESIIGKTYSQVIALIQNSDALLELCVMPKDEDILQLAYSQDAYL
KGNEAYSGNAQNIPEPPPICYPRIEVKAAGMAQSSEPVTVTETPRGPVQGPGRRGGATEK
SYRVEIPVPPPPQQTSKSQTAVCVCNDNVRTVPPDQIERGSRVARAGPSHRTEENRYGPT
TDSGSARPRPLIPSVPGSAQLQYPSSHTTEMPVYSPSSTSRPGIYPDTLSPPGRASQDTF
STAISPSANHYSPSPTAPSTSPHQNIDWKNYTTYKDYIDAKRLHSYGCRTIQERLDTLRA
ASSSSSVYTQQRTTSPPVASQRGALESQVRRRSASNDRGVDTGSQGAAVTAPLRSASQER
LGGRAERTITTRNWPRSASQDALPFSTPTGVTKPRARSCDYLGQHPGELGGLLSGDRLGV
EDRLQLGQGEEARASRQGSGLRALPHLNRSLTGQEEEGQGFSNSPLAAPVFTKGTTDSAL
PSRTDGIVMRPSRLPVKNAISDASPALPSSKPMDPLKDQRANIMGNHMGYSSPLHLQLRS
RADSLKIESRSEAGLAARSSSCSGPSSKLPMQRQLQSADSSSTSNGAVTQKPKVKETSSS
TNSLVWTNGSLAEGVEGPDATVVVLRRDKISGTAHVRPPSYVIAVNDNQRGVTHKSPPLV
KAGSADAAMCWTSSDSYREMHLRRLGDTRQKSGSSNLDDSLDSIPFIDEPSSPSIDLESA
HIPASAVISGTPIITTVPASPPSPSPLIRRQLSHDQDSLRLTIIESDSGTKTERSKSYDE
GLDNYREEGRGRSMIPGLKSLMKAVDRSSDDSGSRRDSSSDVFCDATKEGLLHFKQLHTE
KAKRVGGGMRPWKQMYAVLRGNYLCLYKDKKEGQAHANCQAVDEPLPISIKSCLIDISYS
DTKRKNVLRLTTSDCEYLFQAEDREDMLAWIRVIQENSNLDEENADFTSHDLISRKIKEY
NTLMSPTGSKTEPSPRTSRQSLRQTLLGGKGETKATSPHSPKAEQERKNMHKDDTSPPKD
KGTWRKGIPGLMRKPFEKKPSPGVTFGVRLDDCPPAQTNKFVPLIVEVCCKLVEERGLEY
TGIYRVPGNNAAISNMQEELNNKGMNDIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNE
RYTDFIEANRIEDPVERLKVLKRLLHELPAHHYETLKFLSAHLKTVAENSEKNKMEPRNL
AIVFGPTLVRTTEDNMTHMVTHMPDQYKIVETLIQNYDWFFTEDGNGEPVTVSQEESAVE
SQPVPNIDHLLTNIGRTGTSQGEVSDSPTSDSAKSKGSSGKDQCSRDLLVSSIFAVASRK
RKKSREKPQPSSSDDDLDSVFLKKEILAQKPNQQTEAQGETRPSPNTKPSTKQQARTEER
KENGRTVELTPKAKREHRHSLFLREKITPRRSSPSPLPSPKISNSPNISYQTAPQGKSSL
SDPPSQLDENTSDLGTMSSGASVPRSRPKKWTAGVSPDLPAGVALGASAGASAGAEVSSI
TSDYSTTSSITFLTGAESSALSPELQGGEEADDERSELISEGRPMETDSESDFPVFAPGG
GSSQSTPCPTQSQEKAEAKGGSAIEGGTSPKLEARRLFPTHRMIECDTLSRRWSLKQKTD
SESSVEGAAGSGERSEGRAESSSRLSRVLEVMKKGRSTSSLSSSSRSESERSEPAWHLKI
TERLKFRLRTSADDMFTQKNRSPDGRSKKKNIRRRHTMGGQRDFAELAIINDWREQGGVD
QVAELSALDRLKPRCSSQDLSIRDWIAREQSRGSEQSRGSEPSVEVAPKAVPEDDHAEVH
EERPPERPPPPPPSDSPGAQPPAGEHINGRGLQSKNKGSLGDDAHPHKLSGAQVVRSRFY
QYL
Download sequence
Identical sequences I3JGZ6
ENSONIP00000008137 ENSONIP00000008137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]