SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008138 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008138
Domain Number 1 Region: 1134-1330
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.83e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000232
Further Details:      
 
Domain Number 2 Region: 920-1045
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-29
Family Pleckstrin-homology domain (PH domain) 0.000012
Further Details:      
 
Domain Number 3 Region: 26-144
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000021
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008138   Gene: ENSONIG00000006455   Transcript: ENSONIT00000008143
Sequence length 1858
Comment pep:known_by_projection scaffold:Orenil1.0:GL831138.1:6316252:6364617:1 gene:ENSONIG00000006455 transcript:ENSONIT00000008143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKQKDGRDQSEASAAASPGADDEPFSWPGPKTLRLRRTSQGFGFTLRHFIVYPPESAVHN
SLKDEENGSRGKLPGRQRNRLEPMDTIFVKQVKEGGPAHLFLFCPGDRIVKVNGESIIGK
TYSQVIALIQNSDALLELCVMPKDEDILQLLTCGLQFSRDITALAYSQDAYLKGNEAYSG
NAQNIPEPPPICYPRIEVKAAGMAQSSEPVTVTETPRGPVQGPGRRGGATEKSYRVEIPV
PPPPQQTSKSQTAVCVCNDNVRTVPPDQIERGSRVARAGPSHRTEENRYGPTTDSGSARP
RPLIPSVPGSAQLQYPSSHTTEMPVYSPSSTSRPGIYPDTLSPPGRASQDTFSTAISPSA
NHYSPSPTAPSTSPHQNIDWKNYTTYKDYIDAKRLHSYGCRTIQERLDTLRAASSSSSVY
TQQRTTSPPVASQRGALESQVRRRSASNDRGVDTGSQGAAVTAPLRSASQERLGGRAERT
ITTRNWPRSASQDALPFSTPTGVTKPRARSCDYLGQHPGELGGLLSGDRLGVEDRLQLGQ
GEEARASRQGSGLRALPHLNRSLTGQEEEGQGFSNSPLAAPVFTKGTTDSALPSRTDGIV
MRPSRLPVKNAISDASPALPSSKPMDPLKDQRANIMGNHMGYSSPLHLQLRSRADSLKIE
SRSEAGLAARSSSCSGPSSKLPMQRQLQSADSSSTSNGAVTQKPKTNGSLAEGVEGPDAT
VVVLRRDKISGTAHVRPPSYVIAVNDNQRGAGSADAAMCWTSSDSYREMHLRRLGDTRQK
SGSSNLDDSLDSIPFIDEPSSPSIDLESAHIPASAVISGTPIITTVPASPPSPSPLIRRQ
LSHDQDSLRLTIIESDSGTKTERSKSYDEGLDNYREEGRGSKPRRSMIPGLKSLMKAVDR
SSDDSGSRRDSSSDVFCDATKEGLLHFKQLHTEKAKRVGGGMRPWKQMYAVLRGNYLCLY
KDKKEGQAHANCQAVDEPLPISIKSCLIDISYSDTKRKNVLRLTTSDCEYLFQAEDREDM
LAWIRVIQENSNLDEENADFTSHDLISRKIKEYNTLMSKTEPSPRTSRQSLRQTLLGGKG
ETKATSPHSPKAEQERKNMHKDDTSPPKDKGTWRKGIPGLMRKPFEKKPSPGVTFGVRLD
DCPPAQTNKFVPLIVEVCCKLVEERGLEYTGIYRVPGNNAAISNMQEELNNKGMNDIDIQ
DDKWRDLNVISSLLKSFFRKLPEPLFTNERYTDFIEANRIEDPVERLKVLKRLLHELPAH
HYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTTEDNMTHMVTHMPDQYKIVE
TLIQNYDWFFTEDGNGEPVTVSQEESAVESQPVPNIDHLLTNIGRTGTSQGEVSDSPTSD
SAKSKGSSGKDQCSRDLLVSSIFAVASRKRKKSREKPQPSSSDDDLDSVFLKKEILAQKP
NQQTEAQGETRPSPNTKPSTKQQARTEERKENGRTVELTPKAKRSSPSPLPSPKISNSPN
ISYQTAPQGKSSLSDPPSQLDENTSDLGTMSSGASVPRSRPKKWTAGVSPDLPAGVALGA
SAGASAGAEVSSITSDYSTTSSITFLTGAESSALSPELQGGEEADDERSELISEGRPMET
DSESDFPVFAPGGGSSQSTPCPTQSQEKAEAKGGSAIEGGTSPKLEARRLFPTHRMIECD
TLSRRWSLKQKTDSESSVEGAAGSGERSEGRAESSSRLSRVLEVMKKGRSTSSLSSSSRS
ESERSEPAWHLKITERLKFRLRTSADDMFTQKNRSPDGRSKKKNIRRRHTMGGQRDFAEL
AIINDWREQGGVDQVAELSALDRLKPRCSSQDLSIRDWIAREQSRGSEQSRGSEPSVE
Download sequence
Identical sequences I3JGZ7
ENSONIP00000008138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]