SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008166 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008166
Domain Number 1 Region: 114-387
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-72
Family Protein kinases, catalytic subunit 0.00000000211
Further Details:      
 
Domain Number 2 Region: 380-436
Classification Level Classification E-value
Superfamily SH3-domain 0.000000019
Family SH3-domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000008166
Domain Number - Region: 7-70
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0289
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Domain Number - Region: 966-1001
Classification Level Classification E-value
Superfamily UBA-like 0.0851
Family TAP-C domain-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008166   Gene: ENSONIG00000006477   Transcript: ENSONIT00000008171
Sequence length 1045
Comment pep:known_by_projection scaffold:Orenil1.0:GL831138.1:6534745:6548477:-1 gene:ENSONIG00000006477 transcript:ENSONIT00000008171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCEEGTEWLLELLTDVQLQQYFLRIRDDLNVTRLSHFDYVKNEDLEKIGMGRPGQRRLW
EAVKRRRALYKRKSWMSKVFPVKRPDADPQQPHGASSAAVPASSESGAALTCLIRESELQ
LFERLGDGTFGVVRRGEWTAPNGRVLSVAVKCLKSNVLDSDGLDDFIREVNAMHSLSHQN
LIRLYGIVLTQPMKMVTELAPLGSLLDRLRKRQGHILISSLCNYAVQVACGMAYLEQKRF
LHRDLAARNVLLSTNETVKIGDFGLMRALPKHTDQYVMEEGHKIPFPWCAPESLKSRTFS
HASDTWMFGVTLWEMFTHGQEPWLGLNGSQILHKVDVEAERLCKPDDCPQDIYNVMLQCW
SPKPEDRPTFIALRDFLLETMPTDMRALQDFEEEDKLQITMNDVITIIEGRAEHYWWRGQ
NRRTLRVGQFPRHVVTSVAGLSAQDISRPLKHSFIHTGHGDTDPQRSWGHADRIDSLYLG
NPMDPPDVLGMDSGIARLTKLPNRAKKPFYDSVMDDYDDEEDASASSGLKKLGASLGLKL
RPWEGTGVRSAKSEVSLIDFTDDSFSSTTPSPLTESRQLDEDTLKDRKLLQSASQGNIKA
YDTPSILDWPLPQPAYDEVTAEPEDQSEDQEVRSIYKGLTEEASSSAGLTGRSESQSADL
FQELQREVEKAVVMVKLQVPMATGRSLPSSPLPMPLAPLGPHRQIHLPPPSPSSSSSFAS
CFEDRPVLPPRSPVPPLRPSKHNLSARAINPEARTSSISLGNEDDTPPQIPPRDHAFSQP
GSRSSSPVALPPPPLAVSPRRASGLLGPLLSSNSPSSSSSLPQASSHSSRLGVPGSSYSS
TSLLDPLAFREGRGLSSLIDSSQSSAPVPLPERPAFLERYQRGRQDCVRSPTTIIHIPYF
MFLNRYGTANMAAVKPMMQQQQQHPGGAKPNTSYNNNNGRTAAPSMQREQSITQRECNAQ
KAGDLKHIHKVQGAVHGVTIEECQAALQSHEWSIPQAINHLKVEQLFRLGLRSRAECEEL
LQHHQWDLERASTVMLDTYGPHRNR
Download sequence
Identical sequences I3JH23
ENSONIP00000008166 ENSONIP00000008166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]