SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008290 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008290
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.22e-24
Family Ubiquitin-related 0.0000314
Further Details:      
 
Domain Number 2 Region: 231-297
Classification Level Classification E-value
Superfamily XPC-binding domain 1.83e-22
Family XPC-binding domain 0.0000635
Further Details:      
 
Domain Number 3 Region: 149-204
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000151
Family UBA domain 0.0003
Further Details:      
 
Domain Number 4 Region: 314-362
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000186
Family UBA domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008290   Gene: ENSONIG00000006571   Transcript: ENSONIT00000008295
Sequence length 365
Comment pep:known_by_projection scaffold:Orenil1.0:GL831179.1:4115841:4127335:1 gene:ENSONIG00000006571 transcript:ENSONIT00000008295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQITLKTLQQQTIQIEIDPEQTVKALKEKIEAERGKDNFPVSGQKLIYAGKILQDDTPIK
DYKIDEKNFVVVMVSKAKPAAAASPSVSEAPKPPVQDSGSTSTAAPTTNPTPAPAPAPAA
VPIPSGEAKEESSAVATEPQQPASSSGGSQGLDASSTLVTGAEYEAMLTEIMSMGYERER
VVAALRASFNNPHRAVEYLLTGIPSSPVQESNPPAQAPTSGTTEAPSVPEGENPLAFLRT
QPQFLHMRQAIQQNPALLPALLQQLGRENPQLLQQISQHQELFIQMLNEPVGEGGDAPEV
GEMGAAGEEGAPVNYIQVTPQEKEAIERLKALGFPEALVIQAYFACEKNENLAANFLLNQ
GLEDD
Download sequence
Identical sequences I3JHE6
ENSONIP00000008290 XP_003446521.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]