SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008362 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008362
Domain Number 1 Region: 5-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000252
Family APC10-like 0.057
Further Details:      
 
Domain Number 2 Region: 435-651
Classification Level Classification E-value
Superfamily ARM repeat 0.00000497
Family HEAT repeat 0.046
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000008362
Domain Number - Region: 204-248
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.0196
Family C-terminal UvrC-binding domain of UvrB 0.016
Further Details:      
 
Domain Number - Region: 808-859
Classification Level Classification E-value
Superfamily RING/U-box 0.0318
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008362   Gene: ENSONIG00000006619   Transcript: ENSONIT00000008367
Sequence length 885
Comment pep:known_by_projection scaffold:Orenil1.0:GL831308.1:1172706:1200494:-1 gene:ENSONIG00000006619 transcript:ENSONIT00000008367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKIGFTVVSSSSHEDNFSAKELMVHAPTVNGWRSSRLCSYPQHITLQLVERSRVRKLQ
LLAHQYMIPTKVEFYIGDTPPETSSPGFPGQLRRLGYVSLSDNEKTGFKARELKSVYVDA
IGTYLRITFHRNYGNRYNHYNQVGLVAINVLGDALDGNAFNTIPSREQLIEHYLNSTQLE
AALESTFMGKCESISPLDDLAFDMYQDPEVAHIIRLLDQKKQEMVRQEKYEEAKNLKQAI
ADLQKVGERLARYDVEKQCAIEKEDYDLAKKKKELMEEYRKSVYQQLEVHNLLDMTMVCQ
QPLNDLCYSVFPCHQVTSRMLVKASERAEVINFSKVFLRRKNAVQFSLTFPSLILDAETL
NSIPKPKVTSVPYDERPLPALQRKDRPLEATQSSAEEHSPISEVQRTPQSMEMSGEPEPL
TEKVQREAGLPIDVFGESLVAGAYSKTWCYRVDALLSVYKKLLEVSPTTPKEELRNMIRA
AIFLVKKALLDKVTSVLHASLKLLRLMLSQLIPGVGLGQAEVTHCLEQTLCNLLARTGDS
TTRVRATVSAFIQEIAVLKDVRALQMIPGELVKPFKSNFPSRLAESRAELVEKLLIELGT
ENSGFTLENVMTFCTAALEHSASTVRELAVRIILSVYQKERSAVLSYLPPNDAAVRKNFL
YKNLFDGFAKIDGKLVETQTLKKGGGQLDRQKEKEEIHSLQEQLAALKEITLVKERGNES
TKGQTAKREVHKVTAQQKGNCNLPDPLKFDSLCIFCGKKDESFTEEGLDLHYWKHCPMLR
RCDECRQVVEIASLTEHLLGECENRSKFSQCPLCSEAVATEDLTHHAQGPGCNPPVLGKG
SNHCPLCHSNFTPGEEAWKAHLMGREGCKQNSRRTAASQRTQPAQ
Download sequence
Identical sequences I3JHL8
ENSONIP00000008362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]