SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008538 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008538
Domain Number 1 Region: 835-1007
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.54e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0055
Further Details:      
 
Domain Number 2 Region: 982-1101
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.68e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0047
Further Details:      
 
Domain Number 3 Region: 145-190,307-393
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-26
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 
Domain Number 4 Region: 3-139
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-20
Family Phosphotyrosine-binding domain (PTB) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008538   Gene: ENSONIG00000006762   Transcript: ENSONIT00000008543
Sequence length 1231
Comment pep:known_by_projection scaffold:Orenil1.0:GL831237.1:1141006:1165510:1 gene:ENSONIG00000006762 transcript:ENSONIT00000008543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDKRFALTYIGWSLLDRRTTLPMLPWLVAEIRRRCEKGDCGPVMQPREVHLVLCPPFIRC
VPTTSNNSSVFIFEHKAQLISRFIHNSNDLTYFAYLLRGQPDNPESEMSCHVFKACDPNQ
VPEVISNIRQVSKTALKEDAKPKQETDEAFYNSQKFEVLYCGKVTVGYKKAPSTLVDDCI
DKFRQHEIERKRVRLLNGQQGSTESPPVEFLMGGEGDPLSSALKCGSHPHLCKGLLSSGS
QSSLRGAFPESIQEDSGFEEPQEFRTRCSSMVGSLQRKPGEGIVMVSTRRRHASAPNHVQ
PSDADKNRTMLFQVGRFEVNLISPDSKTVVLEKNFKDISSCCQGIKHTDHFGFICRHHSE
SGPSQYVCYIFQCASESLVDEVMLTLKQAFSTAAALQSNKTQIQLCEACPMHDLHKLCER
IEGLYPPRAKLSIQKYLSQLTDNEQAEIFERVQRLKPASDQEENELVILHLRQLCETKQK
SHLHIGEAPQNAANSSAAGDGAATGSRFKLDIFKNKARSSLTSSLENIFARGASRMRGRL
GSMGSMSSFERSKTPAGQDEESPGHSPPGSPPAFPDEDPEAGFQFRRRAHTFSHPPVKKR
ISFEGQLPIQNKQTPLRRQQSVNPELLQSRTRSVSESESSSSFSLPSSFTAPTFLKSFYQ
GSLGSLSSLPDTGSLKSNGEGRKRTLSGCSSDSFSGGLPLSPRRVSWRQKIFLRVASPMN
KPSASMPHTDDAENRELLPLSPRASSLDPLGQLLPQAGDPGSEKKSKRTAADYRALWKTA
IHQQILLLRMEKENQRLEASRDELHIRKMKLNYQEVSECSKDAQALWERKLTAPGRTTVP
QDKEEMYRALCQGVPKSRRGEVWLLLSHQHRLRHRLPPRQLALDTHYHDLLKQLTAQQHA
ILVDLGRTFPTHQYFSAQLGAGQLSLYNLLKAYSLLDTEVGYCQGISFVAGVLLLHMSEE
QAFDMLKFLMYDLGIRRQYRPDMVSLQIQMYQLTRLLHDYHRELYNHFEEHEICPSLYAA
PWFLTLFASQFPLGFVSRIFDFVFVEGTEVIFKVALCLLGSHEGEIVECDSFESIVDYLK
TTLPALSHTQMEQTIAKVMEMDISKQLQAYEVEYHVLQDEMLESGPLPDDSERLDKLEKT
NAQLKKQNMELLEKLQAARQKIQTLETSMENFLSRESKMKHMIRSLEQERAAYQRTIERM
RSCLPPDALTDVEMTQIKTGPNGKAKTAAKK
Download sequence
Identical sequences I3JI44
ENSONIP00000008538 ENSONIP00000008538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]