SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009602 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009602
Domain Number 1 Region: 426-671
Classification Level Classification E-value
Superfamily vWA-like 5.34e-68
Family Trunk domain of Sec23/24 0.000099
Further Details:      
 
Domain Number 2 Region: 674-769
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 5.49e-36
Family beta-sandwich domain of Sec23/24 0.0018
Further Details:      
 
Domain Number 3 Region: 876-1017
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 3.92e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.0013
Further Details:      
 
Domain Number 4 Region: 178-443
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.22e-33
Family beta-sandwich domain of Sec23/24 0.0047
Further Details:      
 
Domain Number 5 Region: 771-875
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.41e-27
Family Helical domain of Sec23/24 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009602   Gene: ENSONIG00000007619   Transcript: ENSONIT00000009608
Sequence length 1021
Comment pep:known_by_projection scaffold:Orenil1.0:GL831221.1:2124286:2137794:1 gene:ENSONIG00000007619 transcript:ENSONIT00000009608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVAAPPYSQAQPGMGAYQGGFGSGPTQPLYGHYGGPPQAFNAPPAGMMKSSVSPA
ASVPLPPGPSQYNPNVQQNGSHPQSYPAPPAVSAPYGQPPLSLYNSMTSPGPPPTQQLTN
QMSSMNLGSHAQGLQSPPPPASSVVQQPFQTPPTSTMAPPQMPPGPQSPHMSPLMSPPQS
PPASTSMEGMGRPFPGPPPPGPGGFQQPGLGSAGQPGYPQQPGQFGGYMAGAHQNMPGPF
TGPPQKKLDPDSIPSITQVIEDDQVKQGGQVFTTNIRGQVPPLVTTDFTVTDQGNASPRF
IRCTTYSLPCTADLAKQCQVPLAAIIKPFASLPKNETPLYVVNHGDTGPVRCNRCKAYMC
PYMQFIDGGRRYQCGFCNCVNEVPVFYFQHLDHMGRRVDFYERPELSLGSYEFVATLDYC
KNNKPPNPPAYIFMIDVSYNNIKSGLVKLICDELKTLLEKLPREEGMDTSAIKVGFVTYN
KVLHFYNVKSTLAQPQMMVVSDTAEMFVPLLDGFLVNYQDSRAVIYNLLDQIPDMFADTA
ESETVFAPVIQAGVEAFKAAECSGKLFIFHSSMPTAEAPGKLKNRDDKKLVNTDKEKTLF
QPQKGVYEQLSKDCVASGCCVDLFLFPSQYTDIATMADVPSHTGGSVYKYSNFQVETDGE
HFLRDLRKDVQKSIGFDAIMRVRTSTGFRATDFFGGIYMNNTTDVEMAAVDCDKGMTVEF
KHDDTLSEETGALMQCALLYTTISGQRRLRIHNLSLNCSSQLSELYKSCETDSLINFFAK
SAYRAILNQPLKNVREILVNQTAHMLACYRKNCASPSAASQLILPDAMKVFPVYMNSLMK
TAPLVGSTELSTDDRAHQRLSVMAMGVEDTQLLLYPRLIPLHNIDVNSEKPATPVRCSEE
RLTDSGIFLLENGQSMFLWLGQASSPDLIQSLFNLPSLAHLQGHMCALPELDNPLSRKVR
SIISGLLEKRSNSMKLQIVRQKDKPEMLFRQFLVEDKGLHGGASYMDFLCYVHREIRQLL
T
Download sequence
Identical sequences I3JL58
ENSONIP00000009602 ENSONIP00000009602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]