SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009836 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009836
Domain Number 1 Region: 330-500
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-46
Family SPRY domain 0.00084
Further Details:      
 
Domain Number 2 Region: 11-84
Classification Level Classification E-value
Superfamily RING/U-box 1.14e-16
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 146-182
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000142
Family B-box zinc-binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000009836
Domain Number - Region: 183-233
Classification Level Classification E-value
Superfamily BAG domain 0.00863
Family BAG domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009836   Gene: ENSONIG00000007809   Transcript: ENSONIT00000009842
Sequence length 510
Comment pep:novel scaffold:Orenil1.0:GL831503.1:121893:123614:1 gene:ENSONIG00000007809 transcript:ENSONIT00000009842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQRGNQQDSKKLSCSLCLDLLKDPVTIPCGHNYCMNCIKGFWDEEEKNKKIHSCHQCRK
AFIPKPVLQKNTLLAELVEDLKKKKTRLQAAPADHWFAGPEDVACDVCTGRKMKAIKSCL
VCLVSYCEKHLQPHYDAAPLKKHKLVAPSKKLQENICSRHDEVMKIFCRTDQQSICYLCF
NGSADKAVEDSEKMFTELIRLIQEKRSDMKKKVRSRQKTEVSRVKELREKLEQEIAELKR
KDGELEQLSHTEDHNQFLHNYPSLSALSESTHSSSINIRPLRYFEDVTAAVSKTRDKLQD
ILREEWTNISRVVTMVDVLLSQLQPEPKTRDEFLKYSCAITLDPNTANTHLLLSERNRKA
TFKEQQQPYSDHPDRFLPCWQVLSKESLTRRCYWEVKWRGKVYVAVSYKNISRVGRLNDC
VFGLNDKSWALSCDSKSYKFFYNKVQTELSVPEASTLGVYLDNSAGILSFYSVSETTVIL
LHRVQTTFTQPLYAGLMLFERGDTAEFLKL
Download sequence
Identical sequences I3JLU2
ENSONIP00000009836 ENSONIP00000009836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]