SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009841 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009841
Domain Number 1 Region: 377-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-53
Family SPRY domain 0.0004
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily RING/U-box 4.64e-20
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 142-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.02e-16
Family B-box zinc-binding domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009841   Gene: ENSONIG00000007813   Transcript: ENSONIT00000009847
Sequence length 554
Comment pep:novel scaffold:Orenil1.0:GL831201.1:2643276:2648629:-1 gene:ENSONIG00000007813 transcript:ENSONIT00000009847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VETTQQMDQTKFCCSVCLDLLKDPVTIPCGHSYCMNCIKTHWDGDENRKIYSCPQCRQTF
TPRPVLVKSTVLADLVEELKKTGLQAPPADHCYAGPEDVACDVCTGRKMKAFRSCLVCLA
SYCKEHLQPHYEAAPLKKHKRVDPSKKLQENICSRHDEMMKMFCRTDQQCICYLCPVDEH
KGHDTVSAAAERTERQRELEVSRQNIQQRIQDREKDVKLLQQEVEAINQSADQTVKHSEK
IFTKLIHLIQKRSSDVKQQIRSQQETEVSRVKELQEKLEQEITELKRKDAELKQLSHTED
HIQFLHNYPSLSALSESTDSSSINIRPLSYFEDVTAAVSEVRDKLQDILREEWTNISLTV
TEVDVLLSPPEPKTRAGFLKYSCEITLNPNTAHKQLLLSEGNRKVTVMENQQSYSDHPDR
FTGIEQVLSRESLTGRCYWEVEWRGRGASVAVAYKNISRNGDNECLFGLNEKSWALNCNN
NSYTFCYNNIQTRVSGPRSSRVGVYLDHRAGILSFYSVSETMTLLHRVRTTFTQPLYAGL
WPYFCEATAELIKV
Download sequence
Identical sequences I3JLU7
ENSONIP00000009841 ENSONIP00000009841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]