SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009848 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009848
Domain Number 1 Region: 290-460
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-55
Family SPRY domain 0.00047
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 1.48e-19
Family RING finger domain, C3HC4 0.0093
Further Details:      
 
Domain Number 3 Region: 140-199
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.36e-16
Family B-box zinc-binding domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009848   Gene: ENSONIG00000007817   Transcript: ENSONIT00000009854
Sequence length 469
Comment pep:novel scaffold:Orenil1.0:GL831503.1:291352:293043:1 gene:ENSONIG00000007817 transcript:ENSONIT00000009854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRNQLDSEKYSCPICLDLLNDPVTIPCGHSYCMNCIKTHFDEEDRKGIHSCPQCRKTFIP
RPVLKKNVMFAELVEDLKKTGLQAAPADHCYAGPEDVACDVCTGRKLKAIKSCLTCPASY
CEEHLQPHYDAAPLKKHKLVAPSKKLQENICSRHDEVMKIFCRTDQQSICYVCTMDEHKG
HETVPAAAERTEKQKELEVRRLNIQQRIQEREKDVKLLQQEVEAINGSADKAASSINIRP
LSYFEDVTAAVSETRDKLQDILREEWTNISLTVTEEDVLLSPAEPKTRAGFLKYSHEITL
DPNTAHKELLLSEGNRKVTFMEQQQSYSDHPDRFTDFYQVLSRESLIGRCYWEVEWRGGA
VEVAVAYKLISRGGSLNKCLFGYNDKSWALRCYTNSYQFWHNNIHTVLSGPRSSRVGVYL
DHRAGILSFYSVSETMTLLHRVQTTFTQPLYAGLWLLDYGDTAKLIKVK
Download sequence
Identical sequences I3JLV4
ENSONIP00000009848 ENSONIP00000009848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]