SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009888 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009888
Domain Number 1 Region: 374-557
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-58
Family SPRY domain 0.000024
Further Details:      
 
Domain Number 2 Region: 7-75
Classification Level Classification E-value
Superfamily RING/U-box 4.2e-20
Family RING finger domain, C3HC4 0.0063
Further Details:      
 
Domain Number 3 Region: 158-220
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000168
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009888   Gene: ENSONIG00000007845   Transcript: ENSONIT00000009894
Sequence length 560
Comment pep:known_by_projection scaffold:Orenil1.0:GL831294.1:733726:745781:-1 gene:ENSONIG00000007845 transcript:ENSONIT00000009894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFNSLSEEQFSCSICLEIFVEPVSTPCGHSFCKACLQGYWNHSKKFLCPMCKKSYSRKP
EMSVNRVLAEISSQFQGLTVAKGTASQGSRWNLSSDTGQSSSPVKDTGEFAQPGDVPCDA
CIGRKLKARKSCVNCPGSFCESHLRHHKKVKTLTSHRLIEPTFHLEDKICKKHERLLDVY
CRSDHICICSACADATHKSHETVSIDHEFKKKMGNVGKKRSELKHLIKERAKKLDEIKQS
IKVIKASAQKELEESWQVYAELQRLVEQSQAELVELIATRQREAERHAQEMARGLENELS
QLRRRSNELEAHAQTHDKVLFLQNLTSLSPPPEPTDWSAVSINTDLYLGTIRSSVSGLID
KFQDELKRIYGKELRKVQNYATEVILDPATAQRNLTVSDDGQQVRYEERKSTHSEGPKRF
SPALFVLGREGISTGRHYWEVDVSRKTAWTLGVVRASARRKGEIKLSPEGGYWCLWLKNG
EVKALASARLPLMLPSQPSKVGIFLDYEGGQISFYDVKARLHLYSFSDSFSENLYPIFSP
CLTQEGKNNAPLIITHVKHS
Download sequence
Identical sequences I3JLZ4
ENSONIP00000009888 ENSONIP00000009888 XP_003454809.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]