SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009958 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009958
Domain Number 1 Region: 376-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-36
Family SPRY domain 0.0019
Further Details:      
 
Domain Number 2 Region: 11-81
Classification Level Classification E-value
Superfamily RING/U-box 4.29e-19
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 140-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000397
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009958   Gene: ENSONIG00000007900   Transcript: ENSONIT00000009964
Sequence length 556
Comment pep:novel scaffold:Orenil1.0:GL831294.1:1728484:1731450:-1 gene:ENSONIG00000007900 transcript:ENSONIT00000009964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPHGVDLDCIQFSCSVCLDLLKEPVTIHCGHSYCKSCIEDCWDREEEKGEYSCPQCRETF
SHRPVLRRNNMLAEVVNKLKSTKPTCPSLVYASPTDVACDFCCGIRIKATMSCLTCLASY
CPTHLEPHYSVAVLKKHELVAATVSIQEKMCTKHSKLKELYCEQDEQLVCSLCTVDEHKG
HGCVSASALKDKAKNQLALNQSKIQDKVQKKEKELKELSQAEESLKSSALISLNDCDKIF
DELISSMQRKQSEVKQLIKVQEKTATAQVEDRQSQLKEEITKLKRTYAELEKASDADDLI
YLMQNTRFQSPKHLSTSWDSPDGSPGAPPQRSFKDITKCLSELKDKLEMSLKETWPRISA
TVSYVDFSLPPAPSSREELLRYVYPLTLDGTSNYRYLHLICENRRMRPSPGQASAHLGRF
TKFPQVLCREGLADRCYWEVEGHARTLSVAVAYKNISRTSDESQFGKNDKSWSLDCTADG
FLFCHNNVETKVPGSGLCKIGVFLDYKAGTLCFYRVSDPMVLIHQVQTAFIQPLYPGVGI
NYEWYDTGVFAQLVKL
Download sequence
Identical sequences I3JM64
ENSONIP00000009958 ENSONIP00000009958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]