SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010140 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010140
Domain Number 1 Region: 913-1107
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.000045
Further Details:      
 
Domain Number 2 Region: 707-828
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-28
Family Pleckstrin-homology domain (PH domain) 0.0000328
Further Details:      
 
Domain Number 3 Region: 37-163
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010140   Gene: ENSONIG00000008052   Transcript: ENSONIT00000010149
Sequence length 1204
Comment pep:known_by_projection scaffold:Orenil1.0:GL831443.1:369975:416837:1 gene:ENSONIG00000008052 transcript:ENSONIT00000010149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGVTFCVVGIPPHSDAEAKEKRDGILSSSENRCRPLSSSEVEGVLWHGPRTIFLQKNSQ
GFGFTLRHFIVYPPKSFLNNLKDEENGNGTRKGCQRSWLEPMDTIFVKSVKENGPAQQAG
LCTGDRLVKVNGQSILGKTYSQVIALIQNSENILELSIMPKDEDVLQLAYSKDAYMKGNE
PYSGKARNLPEPPPLYHRTNKPSSTSSQTSHNIHSSLDNWQCRTSPVSPPLDNRPPAAST
LPVCWFRSPEDPSIRFAPSGGHHGRSSSAVTALDFHFVNHNAAIASATLPPPRKAPAHVH
VGTLYHQALSDYSHTHGTECMSPQHRSISQDHLAELGLGLTVTPKPSATAVASLEQRRRE
TLLHHQAAAAAHYSCWFSSCGSLSGPAKKSCSETLLAAYAEWPPSERQSGQQVAEPQKRR
GREEEQVGYKSYSPTFSHKAGHVFQQAHSFREPGYSSPHFDWRPATSSSPADTDVGSKFI
TPQSASEEEIMELGEHREVISPVSTTQEVVLRQKLPPGCHTPIQTLQHPHYTTPEELPGL
TPCTSPVPAETVPNRRSSGNLAQNAFDSLSSIPFIGETTSLSPDLRLSSVPLSMVLSHVV
NSPYVMMTLQVNPPILVLISRHIVAACSGSIKNRRSSYLLAITTERSRSCDEGLNTFREE
SPVFSKLPKRVKSFFTDGSLESLQAQEDARSKRHSTSELGIITFSDVHKEGWLHYKQILT
EKGKKVGGSMRPWRRAFSVLRSHSLFLYKDKRDAVIHGAGAEPGQVEHCPISIRCCLIDI
AYSETKRKHTLRLTTQDFCEYLLQAEDNDDMLAWIKVIRENSKTDNEEIGFSRQALINKK
LNDYKKHSLTGSKLDSSPRAHRMMPPFFLAKTDNTSVNRASRSGGSKHDSDDNKALWSIN
IMKKAKKTGVPKAFGVRLEDCQPAVNHKFVPLIVEMCCGVVEATGLEYTGIYRVPGNNAM
VSNLQEHLNKGMDLNTAEERWQDLNVISSLLKTFFRKLPEPLFTDDKYNHFIDANRIEDG
EERLKTMKKLIHELPDHYYHTLKFLLGHLKKVADHSEKNKMEPRNLALVFGPTLVRTSED
NMTDMVTHMPDRYKIVETLILHYDWFFSNEELDKEEKAPDDNWDIQPLPNIDHLLTNIGK
PGMPREASGSTTSDSLKLKLSSASKKDPNTKSIIAAVTHKHKKSPSIHTVSRNTDENSAH
EPAK
Download sequence
Identical sequences I3JMP6
ENSONIP00000010140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]