SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010141 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010141
Domain Number 1 Region: 904-1098
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.000045
Further Details:      
 
Domain Number 2 Region: 698-819
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-28
Family Pleckstrin-homology domain (PH domain) 0.0000328
Further Details:      
 
Domain Number 3 Region: 37-163
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010141   Gene: ENSONIG00000008052   Transcript: ENSONIT00000010150
Sequence length 1195
Comment pep:known_by_projection scaffold:Orenil1.0:GL831443.1:369975:416837:1 gene:ENSONIG00000008052 transcript:ENSONIT00000010150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGVTFCVVGIPPHSDAEAKEKRDGILSSSENRCRPLSSSEVEGVLWHGPRTIFLQKNSQ
GFGFTLRHFIVYPPKSFLNNLKDEENGNGTRKGCQRSWLEPMDTIFVKSVKENGPAQQAG
LCTGDRLVKVNGQSILGKTYSQVIALIQNSENILELSIMPKDEDVLQLAYSKDAYMKGNE
PYSGKARNLPEPPPLYHRTNKPSSTSSQTSHNIHSSLDNWQCRTSPVSPPLDNRPPAAST
LPVCWFRSPEDPSIRFAPSGGHHGRSSSAVTALDFHFVNHNAAIASATLPPPRKAPAHVH
VGTLYHQALSDYSHTHGTECMSPQHRSISQDHLAELGLGLTVTPKPSATAVASLEQRRRE
TLLHHQAAAAAHYSCWFSSCGSLSGPAKKSCSETLLAAYAEWPPSERQSGQQVAEPQKRR
GREEEQVGYKSYSPTFSHKAGHVFQQAHSFREPGYSSPHFDWRPATSSSPADTDSASEEE
IMELGEHREVISPVSTTQEVVLRQKLPPGCHTPIQTLQHPHYTTPEELPGLTPCTSPVPA
ETVPNRRSSGNLAQNAFDSLSSIPFIGETTSLSPDLRLSSVPLSMVLSHVVNSPYVMMTL
QVNPPILVLISRHIVAACSGSIKNRRSSYLLAITTERSRSCDEGLNTFREESPVFSKLPK
RVKSFFTDGSLESLQAQEDARSKRHSTSELGIITFSDVHKEGWLHYKQILTEKGKKVGGS
MRPWRRAFSVLRSHSLFLYKDKRDAVIHGAGAEPGQVEHCPISIRCCLIDIAYSETKRKH
TLRLTTQDFCEYLLQAEDNDDMLAWIKVIRENSKTDNEEIGFSRQALINKKLNDYKKHSL
TGSKLDSSPRAHRMMPPFFLAKTDNTSVNRASRSGGSKHDSDDNKALWSINIMKKAKKTG
VPKAFGVRLEDCQPAVNHKFVPLIVEMCCGVVEATGLEYTGIYRVPGNNAMVSNLQEHLN
KGMDLNTAEERWQDLNVISSLLKTFFRKLPEPLFTDDKYNHFIDANRIEDGEERLKTMKK
LIHELPDHYYHTLKFLLGHLKKVADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTHM
PDRYKIVETLILHYDWFFSNEELDKEEKAPDDNWDIQPLPNIDHLLTNIGKPGMPREASG
STTSDSLKLKLSSASKKDPNTKSIIAAVTHKHKKSPSIHTVSRNTDENSAHEPAK
Download sequence
Identical sequences I3JMP7
ENSONIP00000010141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]