SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010597 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010597
Domain Number 1 Region: 823-1012
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.3e-64
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000933
Further Details:      
 
Domain Number 2 Region: 519-784
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.69e-47
Family Protein kinases, catalytic subunit 0.00038
Further Details:      
 
Domain Number 3 Region: 59-439
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.3e-43
Family L-arabinose binding protein-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010597   Gene: ENSONIG00000008430   Transcript: ENSONIT00000010606
Sequence length 1094
Comment pep:known_by_projection scaffold:Orenil1.0:GL831154.1:2708773:2725492:-1 gene:ENSONIG00000008430 transcript:ENSONIT00000010606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTRAKNSEGKMKISGIRMSALLYLGALTVAMVTSDMIEDCLNTNRSYYMNVVLLEDNTY
EWSMPLVKAAVEEAILTDKLENDKYGLNFTLTANFNGFNTNLYKRQGCGSSTCEGLTILK
KLNANGEVGCVMLGPSCTYATYQLVDENIGLRLTIPIISAGSFGLSCDYKPKLTRILPPA
RKICDFFLNFMNETLPFKEEPWSRFYVYKKANNVSEDCFWYINALTAATNKFMLGTKTEA
IHGEDGLKKMFQSPKRHSNILILCGNTDEVVSVKGMVGQIPKEFLFILIDVYNPDYYVST
TSVVGMEDVLVVTLPQRIYTTGSSVNETINDYVAGYHDGTLLFGKVLRERMLSNQKNNGT
YNGSNDNPFGDISFYGMGGHYVLDEYGDRDVNFSVIYTSANTAKYNTLLLFDTSQNMTIN
YTQNPSLPWAGNKLPSDEPKTPDEFDMQEIIVIVLSLSVVVVTGVALIFYRQNRKERFLQ
KKWSHIEPHLIGPLDEKEVSLKIDEDKRKDSTYFRQRGRYDKKPVILKELKQTEGDFTED
QRIELNTLLRIDYYNLTKFYGTVKFEYGVYGVFELCQRGSLRYILSDRISYPDETFMDME
FKISVMYDIAKGMSYLHSSNIAVHGRLKSSNCVVDNRMVVKITDFGCNTILKPGNDLWTA
PEHLRKGGVSQKGDVYSYAIIAHEIVMRQAPFYTQYCTDVREKIYRVQHPIGQNIFRPDL
NFEGVTDRETELYTLIKNCWEEDPERRPDFKRIELTIGNIFSNLHNQATETYMDNLIRRL
QMYSRTLENLVEERTALYKAERDRADRLNFMLLPGPVVRSLKETGSVEPELFEEVTIYFS
DIVGFTTLCYYSTPMEVVDMLNEIYKNFDSILDHHDVYKVETIGDAYMVASGLPNRNGNR
HAVDIAHMALDILSFVGTFELEHLPGIPLWIRIGVHSGPCAAGVVGNKMPRYCLFGDTVN
TASRMESTGLPLRIHVSQSTINILQRTDCKFEYEKRGETYLKGKGKMMTYWLTGVTGGSY
NLPTPPTAENFQSLQKDLSEMIVSSLEKRGGDSFKKRKTLSTRSRRRETNSSVQSDSLPE
YFHLAVTENPSTYL
Download sequence
Identical sequences I3JP03
XP_003443256.2.78416 ENSONIP00000010597 ENSONIP00000010597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]