SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010646 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010646
Domain Number 1 Region: 385-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-46
Family SPRY domain 0.0000834
Further Details:      
 
Domain Number 2 Region: 145-211
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000029
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 11-63
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000379
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000010646
Domain Number - Region: 209-307
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0171
Family Fibrinogen coiled-coil and central regions 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010646   Gene: ENSONIG00000008469   Transcript: ENSONIT00000010655
Sequence length 557
Comment pep:known_by_projection scaffold:Orenil1.0:GL831160.1:1388035:1394786:-1 gene:ENSONIG00000008469 transcript:ENSONIT00000010655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNKMGASLDTPARCPLCNELTRDPVTLKCNHRFCQRCIGDLWSINPNGPYHCPEWRCSST
SNNEHKSEKVVILDDSDNEVDICEAPPPATPKAENKSTTPVPCHYCPKTRCQSAVKTCLV
CGASMCSEHLRPHLDTPVFQNHTLVSPVEDISLWKCQDHHEMNRIYCRQCAVCVCTVCTV
IGSHRDHECVSIREAERELRGNLKEEIKQLQEAEQQVKDRVTELAQKKETFKELLSEAQA
GVKQQYSTIKEALEQEEQLALRCVKKEENRVLGGLEEKLCHLHSSLQSIQQGLHTLESLA
DTRDHFCWLKKYMHIFTGIQQDCPALNVLPENHSFVNMLHNRLLYFNRSDWTQLSSIHKA
KIEILTGSSLNSSSLIVYTDGTIPLLDSDTAHPKLQLSDNNRTVTYSDAQQAYTEHEARF
SSFPQVLSSLALEGGRWYWEVSVSVDDGRWKVGLCEAQIERKGQKDNSRLGFNSYSWCLA
CDKRKVEALHNKVSVPVDSDGLQRVGVFLDFEDGILSFFNVTPGGSLALMHSYKQRFTNP
LYPAFSVSKTHLSICDL
Download sequence
Identical sequences I3JP52
ENSONIP00000010646 ENSONIP00000010646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]