SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011266 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011266
Domain Number 1 Region: 765-937
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 
Domain Number 2 Region: 912-1032
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0052
Further Details:      
 
Domain Number 3 Region: 161-189,257-360
Classification Level Classification E-value
Superfamily PH domain-like 8.2e-29
Family Phosphotyrosine-binding domain (PTB) 0.0085
Further Details:      
 
Domain Number 4 Region: 15-149
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-16
Family Phosphotyrosine-binding domain (PTB) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011266   Gene: ENSONIG00000008961   Transcript: ENSONIT00000011275
Sequence length 1131
Comment pep:known_by_projection scaffold:Orenil1.0:GL831245.1:1557563:1601138:1 gene:ENSONIG00000008961 transcript:ENSONIT00000011275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RERTASWGAKVEGEEDEVRYKLAMIGFRKVHHLTTMAMLPWVVAEISRSQPSEREQSGSQ
TVFLCVSASRVRCVSTLGESLVWDPLTHTVLFECLPHHVTKLIHNSQEPSSFACLVRGTP
TCACYVFQCQYRTKVPEIISTLRQAGKSSARNNDITTVSNKASTAFSKKFEVLYCGRVSV
AHKKAPPALIDECIEKFSQLRGSGTADKGANNGAAESPTTGKRPVLFKRDPSFPCLQALD
ENGLSPEISNSNTTDPRTRSADVQPTSLKENRTMLFVVGRSQIFLVSPDTKKVAIEKSFR
EISFCSQGIRHVDHFGFICRETVEGGNCHFVCYVFQCTDESLVDEIMLTLKQAFSVAALQ
QNAKTQSQQCDSCPMQQLHRLCESIEGLHPSKTKLELQKHLATLDNDDQASVFENTMRAR
PKSDQEENELIMASLRSLYEERQKTHQHTVQKESKQMCEDVAPPVEAQQQSSSRQRLEEF
KSRAKRSLTESLEGIWKGSSKARAQRENSEESESSSSICTVNSSQDQPCLDDPLPAHQRS
TSPLRSLSALKLSHSSSSLSADAQPQGFRRRASTFSHPTTPSSAEYSPEHILIHPPQDHS
AASKHKLVRHYSVSTDTPHQSNDVVALSTPSAAGGVGESPQRSHRHSWRQQIFLRVATPQ
KGTDSIGFYEEYAVVGQIVGGGSGDTAMRPVPEEKTKRTKEELRDLWKKAILQQILLQRM
ERENQKLQASENDLQNKRLKLDYEEITPCLKEVTLVWEKMLGTPGRAKVKFDAETIHTAV
AQGVPRQHRGEIWKFLAEQYRLRQTVPSRPPSNHTPYKELLKQLTSQQHAILIDLGRTFP
THPYFQAQLGAGQLSLYNILKAYSLLDPEVGYCQGLSFIAGVLLLHMGEEDAFNMLKFLM
YDAGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYSHLEQQEIGPSLYATPWFLTVFASH
FPLGFVARVFDMLFLQGSEVIFKVALSLLGSHKPLILQHDSLESIVDFIKTMLPNLGLVQ
MEKTINQVCEMDVSKQLQAYEVEYHVLQDELLDTPPTLNQQQRAAQLERTNQSLRQQNLD
LLEELQVSHARVCNLESRVEALAQVEGQLKEQVSALEEEKKQLLNTITHLQ
Download sequence
Identical sequences I3JQX2
ENSONIP00000011266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]