SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011282 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011282
Domain Number 1 Region: 435-632
Classification Level Classification E-value
Superfamily Kelch motif 8.76e-59
Family Kelch motif 0.0000109
Further Details:      
 
Domain Number 2 Region: 168-282
Classification Level Classification E-value
Superfamily POZ domain 3.77e-32
Family BTB/POZ domain 0.0029
Further Details:      
 
Domain Number 3 Region: 606-720
Classification Level Classification E-value
Superfamily Kelch motif 6.41e-31
Family Kelch motif 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011282   Gene: ENSONIG00000008972   Transcript: ENSONIT00000011291
Sequence length 722
Comment pep:known_by_projection scaffold:Orenil1.0:GL831245.1:1702437:1738880:1 gene:ENSONIG00000008972 transcript:ENSONIT00000011291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSSSRKEFDVKQILRIRWRWFGHPAVPPLGVGAVREERQLERRGAPVPARSASQSAEAP
PQRCPGSPRRLNVALAPGSACFHAYAERSVLHLCGHPAVVTEFFHLKSQEEYPKSISKEN
DLWRLLCSKQLPAMSEENRTSNSSATLSSCVSMEQCACPEECMFTALSHADVTFRKMEGY
LRSRQLCDVTLVAGERRIPAHRLVLSSVSDYFAAMFTSDVREAKQDEVKMEGVDPDALWV
LVQYAYTGRLELREDTIESLLSASCLLQLSSVVQACCSFLMKQLHPSNCLGIRSYADAQG
CHDLQRAAHAYTMEHFLEVVGGQEFLLLPVEEMERLLTSDDINVPDEETVVTSLLTWVRH
DASTRQRHLPRLLAHVRLPLLQPQFLADLESNPLLRESVECQRLLMEGMKYHLLPQRRPL
LQSPRTRPRKATVGAMFAVGGMDATKGATTIEQYCLRRDTWRQVATMSGRRLQFGVAVLD
GRLYVVGGRDGLKTLNTVECYNPHSKTWSVMPPMSTHRHGLGVAVLEGPMYAVGGHDGWS
YLSTVERWDPQGRQWSFVASMVTPRSTVGVAVLNGKLYAVGGRDGSSCLRSVECFDPHTN
RWSGCAPMAKRRGGVGVATWHGFLYAIGGHDAPASSLASRLSDCVERYDPQTDVWTAVAP
MSISRDAVGVCLLGDRLYAVGGYDGQVYLNTVEAYDPQTNEWKQVAPLCLGRAGACVVAV
RL
Download sequence
Identical sequences I3JQY8
ENSONIP00000011282 ENSONIP00000011282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]