SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011461 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011461
Domain Number 1 Region: 347-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-66
Family SPRY domain 0.00000266
Further Details:      
 
Domain Number 2 Region: 10-81
Classification Level Classification E-value
Superfamily RING/U-box 7.73e-21
Family RING finger domain, C3HC4 0.0071
Further Details:      
 
Domain Number 3 Region: 131-195
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.36e-17
Family B-box zinc-binding domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011461   Gene: ENSONIG00000009114   Transcript: ENSONIT00000011470
Sequence length 536
Comment pep:novel scaffold:Orenil1.0:GL831379.1:160841:163804:1 gene:ENSONIG00000009114 transcript:ENSONIT00000011470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASNLRSEDQFLCSICLDVFTDPVSTPCGHNFCKTCISQHWDINQSCQCPMCKETFYT
RPQLRVNTFISEMVAQFRQQQGAKPGEVPCDVCTGTRLKALKSCLVCQTSYCQTHLEPHL
TVKGLKRHQLIDAVENLEGRMCTKHDKLLELFCKTDQTCVCVICSVLDHKNHKFVPLREE
YEGKKAELGKTEAEIQQMIQKRRLKIQEITESVKMSKDAADRQKAEGVQVFTALMESVER
RLKELMKEIEDKQETTEKQAEGLIKDVEKEISELMERSSEVEQLSRSEDHLHLLQSFSSM
KTAPPTKDWTEVRVRSPSYEGTVGRAVAQLEETVWKPMKKKLLEAELQRVQQYEVDVTLD
PDTANPALILSDDRKQVYHSDARKNRPDNPERFSYYGIVLGEQSFSSGKFYFEVQVKGKT
KWDLGVATESINRKGEITLRPQDGFWTVVLRNGNEYKALAGPSVPLYLQPGPKKVGVFVD
YEEGLVSFYDVGAAALIHSFTGCSFTHKLHPYFCQMVNLGGKNSAPLIICPVNQTE
Download sequence
Identical sequences I3JRG7
ENSONIP00000011461 ENSONIP00000011461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]