SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011539 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011539
Domain Number 1 Region: 311-445
Classification Level Classification E-value
Superfamily C-type lectin-like 6.92e-39
Family C-type lectin domain 0.00023
Further Details:      
 
Domain Number 2 Region: 604-747
Classification Level Classification E-value
Superfamily C-type lectin-like 1.59e-35
Family C-type lectin domain 0.0000473
Further Details:      
 
Domain Number 3 Region: 1172-1319
Classification Level Classification E-value
Superfamily C-type lectin-like 5.97e-32
Family C-type lectin domain 0.00055
Further Details:      
 
Domain Number 4 Region: 752-885
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-32
Family C-type lectin domain 0.00061
Further Details:      
 
Domain Number 5 Region: 458-585
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-30
Family C-type lectin domain 0.00094
Further Details:      
 
Domain Number 6 Region: 895-1039
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-30
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 7 Region: 185-302
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-27
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 8 Region: 1059-1176
Classification Level Classification E-value
Superfamily C-type lectin-like 1.61e-25
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 9 Region: 114-171
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000174
Family Fibronectin type II module 0.0013
Further Details:      
 
Domain Number 10 Region: 20-114
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000000634
Family Cysteine rich domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011539   Gene: ENSONIG00000009179   Transcript: ENSONIT00000011548
Sequence length 1413
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:644897:659984:1 gene:ENSONIG00000009179 transcript:ENSONIT00000011548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFSPVATGFCLVKLNNFCLSMRWTSGDRLLVQYKKKCLGVQGKTVGSEVNFYDCDETSEL
QKWECKNETVIALKGQELYINLTADNSAVLSNKVGPNSHLTISGTSSGACTRTYTELYTI
EGNAAGRPCMFPFFYKSNWYSECTAFDSAGNRKWCAVETKYDHELWGYCPTNSKETWNKD
PTTGASYQLNTQSALTWDQADASCKQQGASLLSISNPHEQAYVSALLGANRGQEYKLWVG
LIFQDLDYVWKWSNGNPYAYLNWDSGHPVSNPGYKCGIIDGAVQYSWQSSKCNKKLGYIC
YSEGPLAAPTEAAETGFCTAPWIPYNSDCFYLYRNETKKWSDAQKACRKEGGDLVSIRNV
EDQSFIISQLGYASTDELWIGLNDRKRERLFVWSDHSPVSYTSWDSREPTVTSEQQDCVL
IRGENGNWADRVCEEKHGFICMKTSDSEPSGDEVELNAGCKTGWKRHGSYCYFVGTETKT
FHEANDDCKSSKSYLADISTGVDNAFLINLVGLRPEKHFWIGLSNLKNREYFMWTNNAYA
RYTHWNTNMPAQGHVQGCVAMATGHFAGLWDVLPCTNKEKYICKHLAEGEALTPAPPTTA
TPNCTDGWKRSSKPKCFEIFPEDSEERKTWYEARDYCRAIGGDLVSIHSSADLLHTQSYS
YYHWINQYWIGLSAPDPDTGYVWSDGSPVNFQKWKDGEPNNKNDAEFCVEMEHEHWGGTF
FWSDVHCEKYNGWICQIHAGDTPKPAPDPVTPAYNTTSDGWLEWNGAQYYINKNEMAMED
ARTFCRQRHGDLVFINSEAERIFLWKQISTGYWNSWIGLSVDLDGTFQWMDGSQVLFQRW
DENQPKFKNFDENCAVMTHHNGFWHDSNCGLEYISFCKRSSSPPTNTTAAVPTVSPKGGC
PPPWKKFNSKCYSVIYNQNLTWHDAREKCRQKGGQLASITSRQVEVFLLSQMVGAPTTDL
WIGLFQSEWTTYWSDGQPKSYTNLGDNVTNDKTSEKTYRKKNCFVINTKPLAGIGKWILK
SCNDTNGFICHRNLDTSRPDPPEPTISTNYIKILNDSIKVVPQQMKWDKAAEYCKNDDAL
LASLRNEWTQAYVELLALNLKAPLWFGLHKVQINGSFRYVDGWHLIFSRWGTNEPRKDRS
CVYMDVDGKWKTAHCNETLMSVCMKSTDVLPTESTIFPGVCPQDPEATLESNNYIWVPFR
GYCYIFITEQKYWQEASTSCVAHGGMLPSIEDSSEQKFLEINLRTFQDSYTSFWIGLFKK
QYKEEWLWLDRTVMGYTNWAEGQPDNMSFGSRTGEISTSDGTWKDMEMWVRRPYICKTQK
GKLITSTFSLCTETGLPHQQRVYITTAVVLVITGIAVVAVTAVFIFKKFRHQLPAPNTFD
NPLFFNSRVSQPEQADTSILVENAVEENTGNLI
Download sequence
Identical sequences I3JRP5
ENSONIP00000011539 ENSONIP00000011539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]