SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011542 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011542
Domain Number 1 Region: 335-463
Classification Level Classification E-value
Superfamily C-type lectin-like 4.98e-39
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 2 Region: 768-896
Classification Level Classification E-value
Superfamily C-type lectin-like 3.44e-35
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 610-754
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-34
Family C-type lectin domain 0.0000525
Further Details:      
 
Domain Number 4 Region: 904-1062
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-30
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 5 Region: 1222-1346
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-30
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 6 Region: 201-323
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-30
Family C-type lectin domain 0.0026
Further Details:      
 
Domain Number 7 Region: 476-608
Classification Level Classification E-value
Superfamily C-type lectin-like 4.55e-29
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 8 Region: 1087-1213
Classification Level Classification E-value
Superfamily C-type lectin-like 1.99e-25
Family C-type lectin domain 0.0037
Further Details:      
 
Domain Number 9 Region: 21-140
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.41e-16
Family Cysteine rich domain 0.0031
Further Details:      
 
Domain Number 10 Region: 139-196
Classification Level Classification E-value
Superfamily Kringle-like 7.99e-16
Family Fibronectin type II module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011542   Gene: ENSONIG00000009182   Transcript: ENSONIT00000011551
Sequence length 1424
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:664102:683099:1 gene:ENSONIG00000009182 transcript:ENSONIT00000011551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRITCKVFVILIQTFYGLASDDSPFQLTNSATGFCLIKTNNHCNDIRWTTGDRLLVLERN
KCLGVQGKSVGSEVNLYDCDEASELQKWECKNETVLALKGQELYIELTADSTAILSRTTG
PNNHLTISGTSSGACTRTYRELFTIGGNAAGRPCMFPFLYKTQWYSDCTKFDSSEKRLWC
AVETNYQSERWGYCPTMSKEDWNMHPTTGAYYQLNIQSALTWHQAQVSCKQQGASLLSID
DPHEQAYITALLWKGGNTLWIGLILDPEHGWKWINGRPYRYMKWDSGHPLPNPGYNCAVV
DPSVRYLWQSLPCSNKLGYICYSKGAEEAPTQAGTGFCSNPWIHYNGHCFHRNRAQKTWS
EAQVACHQDGGDLVSIHSVEDQSFIISQLGYTSTDQLWIGMNDRKTEGLFDWSDHSTVTF
TSWEFGKPAVSSEIKDCVLMHGENGNWADRGCEEQHGFICKKMSALRPSGEEVEQNTGCK
NGWRRHGSYCYFIGIQTKTFDEAKDDCKGSLSYLADVSNGVDNAFLVSLVGMRPEKYFWL
GLSNQKNTEEFVWTNTDSVRFTHWNAEMPGNRQGCVAMKTGIFAGLWDVVPCTNKEKYIC
KHLAEGAVLTPPPPTLFPPECASGWTRLGFSNRCFKLFDRYSRQKRTWYEAKDYCRAIGG
DLLSIHSSAELQSVQLRFKAVWIGLSAPDPDTGYVWSDGTPLNFQQWKIGEPNNKNNVES
CVEMKPERTFRRHTLWSDIHCEKYSDWLCQIRAGVTPNPPPDPVTPSYNKTSDGWFEWNR
NHYYINRNQMGMEDARRYCQQRHSDLVTISSEAERVFLWKLIQDTGYRPYWIGLIVDLDG
TFAWMDDSPVIFQAWSENQPDFQNNDENCVAITPSTGFWHDYNCGFQLSFICKRNSSVPE
HISVVPTALPKGGCPQDWKKFHSKCYSIISRELETWEGARTQCKNKGGNLASILSKHVQV
FLTSKMLDAPTTDLWIGLHYLLGYSFYWTDGQPVRYTNWHSLQMTGHWMHFTDDEDERDH
RGYFSRDARKGCAVMTTDRTTGIGKWDQRSCSDKNGYICLRNLDPSLPDSPEPTANNGYV
KIFNDSIKVVTQKMNWDSAKKYCELDGANLASLRNEWSQVYVELMALEMKGPLWIGLNKK
QTGYFRFIEGWEMTFSNWDRLEPEMYQSCVYVNNENGKWKTADCAHNMASVCMKSTDVPP
TESTESVSFPGNCPEDPASRAGYTWVPFKGYCYLFVKGSYDWGDASAQCIRYGGTLTSIE
NPAEQRFIFNNVLVFKDSQRFFWIGMYQTHKGLWKWLDKTAIDYVSWGPNEPDGMGTYGA
IASLDGNWTTSRMYNTRGFICKAPKVLQAPTTIASSSIEDPKANGHMVLEVMLGITVTAI
GIIIVIFLLKKSGICQSISENLTTFDNPMFFNNEQVQAGVVGEN
Download sequence
Identical sequences I3JRP8
ENSONIP00000011542 XP_005476623.2.78416 ENSONIP00000011542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]