SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011543 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011543
Domain Number 1 Region: 470-634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-49
Family SPRY domain 0.00013
Further Details:      
 
Domain Number 2 Region: 13-89
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-19
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 149-209
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000412
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011543   Gene: ENSONIG00000009183   Transcript: ENSONIT00000011552
Sequence length 644
Comment pep:novel scaffold:Orenil1.0:GL831205.1:1861339:1865389:-1 gene:ENSONIG00000009183 transcript:ENSONIT00000011552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPRIMSLSKPEDQLAYELSCPICLQLYSDPVALPCGHNYCLSCIRKTIDSTDKTGKILPR
CPECREEYPGMDNLQINFKLRSIIENYKATAPLLNMQADCVDTKMEVFCDQCIDEQSPAV
KTCLKCEVSLCSRHLQKHNEKELFRTHPVVEPTTELRVKACAIHQRPLEYFCSNDMISLC
TTCIVEGHHESHDVLTFSIAEEEMRRGLEARNKVISSRLQLTEGLLQKTAEDQGASEAVG
DKMVSKAVTVMDSIGALVDRGGRTVFLPDLLSDKRIYRMRFIFSAANKNTDQNAGPSKNV
ACIEINNLKPGLLVLCIISASFISQTFSQYQVFTERTKTKQNKKLTYRDRLLSLLEEERG
QRRKSWQLGMSALEEQQQQLMEAQKSATEVLNETDTCIFIHRYRNLPCYYKFMQIEQKLR
DVVTSAIPSYIPSKTPLNTMLLQGGLKTQDFCTEMTRLMDSLHILLNPLELTFSIYTAHP
NLLVSNDLRTVKYSSNKQSYPEHPERFTSTPQILCSQGFSGGEHVWVVEVGPNSMWSLGV
CYKSIPRRGDHSRLGHNTVSWRLQWKNGKLTVCQCSSNVVLKEVTTPPVKIEVTLDYEGG
TLTFHSTKGRREHLHTLKAVFKEPVYPAFGIHSNTPDSWITLSS
Download sequence
Identical sequences I3JRP9
ENSONIP00000011543 ENSONIP00000011543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]